From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_001729 [new locus tag: EGJ38_RS08635 ]
  • pan locus tag?: SAUPAN004406000
  • symbol: facZ
  • pan gene symbol?: facZ
  • synonym:
  • alternate name: JSNZ_001729
  • product: DUF948 domain-containing protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_001729 [new locus tag: EGJ38_RS08635 ]
  • symbol: facZ
  • product: DUF948 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1773693..1774184
  • length: 492
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423685 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGATTGGATTTTACCAATTGCTGGAATTATCGCTGCGATTGCATTCTTAATTTTATGT
    ATCGGTATCGTAGCTGTATTAAATTCTGTTAAGAAAAACTTAGATTATGTTGCAAAAACA
    CTTGACGGTGTAGAAGGTCAAGTTCAAGGTATTACTCGTGAAACAACAGATTTACTTCAC
    AAAGTAAACCGTTTAACTGAGGATATCCAAGGTAAAGTAGATCGTTTAAACTCAGTTGTA
    GATGCTGTTAAAGGTATCGGTGACTCAGTACAAACGTTAAACAGCTCTGTAGATCGTGTA
    ACAAATTCAATTACACATAATATTTCTCAAAATGAAGATAAAATCTCACAAGTTGTTCAA
    TGGTCAAATGTTGCAATGGAAATTGCAGACAAATGGCAAAATAGACACTACCGTCGTGGA
    AGTGCAAATTACAAAGCTAATAATGTAGCAACTGATGCAAATCATAGCTATACTTCTAGA
    GTAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_001729 [new locus tag: EGJ38_RS08635 ]
  • symbol: FacZ
  • description: DUF948 domain-containing protein
  • length: 163
  • theoretical pI: 7.67054
  • theoretical MW: 18002.2
  • GRAVY: -0.220245

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis virulence factor Mce family protein (TIGR00996; HMM-score: 33)
    and 7 more
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)
    helix-rich protein (TIGR04523; HMM-score: 14.1)
    Metabolism Transport and binding proteins Unknown substrate transport protein (TIGR00833; HMM-score: 13.5)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)
    two transmembrane protein (TIGR04527; HMM-score: 10.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 103.1)
    and 44 more
    TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 26.9)
    no clan defined DUF7310; Coiled-coil region of unknown function (DUF7310) (PF23991; HMM-score: 26)
    Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 22.5)
    Concanavalin (CL0004) Laminin_II; Laminin Domain II (PF06009; HMM-score: 21.3)
    no clan defined Focal_AT; Focal adhesion targeting region (PF03623; HMM-score: 19.6)
    HsbA; Hydrophobic surface binding protein A (PF12296; HMM-score: 18.5)
    TPR (CL0020) Sec10_N; Exocyst complex component Sec10, N-terminal (PF20667; HMM-score: 17.9)
    NUDIX (CL0261) NUDIX_5; NUDIX, or N-terminal NPxY motif-rich, region of KRIT (PF16705; HMM-score: 17.7)
    no clan defined Gp58; gp58-like protein (PF07902; HMM-score: 16.8)
    Chlorosome_CsmC; Chlorosome envelope protein C (PF11098; HMM-score: 16.6)
    BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 16.3)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 16.1)
    Mce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 16.1)
    DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 16)
    MCPsignal; Methyl-accepting chemotaxis protein (MCP) signalling domain (PF00015; HMM-score: 15.9)
    BORCS6; BLOC-1-related complex sub-unit 6 C-terminal helix (PF10157; HMM-score: 15.8)
    NPV_P10; Nucleopolyhedrovirus P10 protein (PF05531; HMM-score: 15.7)
    TPR (CL0020) COG3_N; Conserved oligomeric Golgi complex subunit 3, N-terminal (PF04136; HMM-score: 15.6)
    no clan defined Tweety; Tweety (PF04906; HMM-score: 15.6)
    Ferritin (CL0044) DUF2383; Domain of unknown function (DUF2383) (PF09537; HMM-score: 15.6)
    STAND_N (CL0587) SesA; N-terminal domain on NACHT_NTPase and P-loop NTPases (PF17107; HMM-score: 15.4)
    no clan defined BORCS8; BLOC-1-related complex sub-unit 8 (PF10167; HMM-score: 14.6)
    DUF7217; Domain of unknown function (DUF7217) (PF23854; HMM-score: 14.6)
    Fzo_mitofusin; fzo-like conserved region (PF04799; HMM-score: 14.4)
    UPF0184; Uncharacterised protein family (UPF0184) (PF03670; HMM-score: 14.3)
    DUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 14.2)
    Prominin; Prominin (PF05478; HMM-score: 14.1)
    Spectrin (CL0743) Spectrin_Anc-1; Nuclear anchorage protein 1, spectrin-like repeat (PF24611; HMM-score: 14)
    no clan defined Laminin_I; Laminin Domain I (PF06008; HMM-score: 13.9)
    PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 13.8)
    Apolipoprotein (CL0725) ApoLp-III; Apolipophorin-III precursor (apoLp-III) (PF07464; HMM-score: 13.8)
    no clan defined BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 13.6)
    TPR (CL0020) COG4_N; Conserved oligomeric Golgi complex subunit 4, N-terminal (PF20663; HMM-score: 13.4)
    no clan defined AI-2E_transport; AI-2E family transporter (PF01594; HMM-score: 13.2)
    TPR (CL0020) COG5_N; Conserved oligomeric Golgi complex subunit 5, N-terminal (PF10392; HMM-score: 13.2)
    no clan defined DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 12.9)
    TPR (CL0020) EXOC6_Sec15_N; Exocyst complex component EXOC6/Sec15, N-terminal (PF20651; HMM-score: 12.8)
    no clan defined DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 12.7)
    DUF6674; Family of unknown function (DUF6674) (PF20379; HMM-score: 12.7)
    DivIVA; DivIVA protein (PF05103; HMM-score: 12.4)
    Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 12.3)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 12.1)
    E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 11.2)
    no clan defined GP41; Retroviral envelope protein (PF00517; HMM-score: 8.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0103
    • Cytoplasmic Membrane Score: 0.9886
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0009
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.089509
    • TAT(Tat/SPI): 0.00082
    • LIPO(Sec/SPII): 0.071432
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423685 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MDWILPIAGIIAAIAFLILCIGIVAVLNSVKKNLDYVAKTLDGVEGQVQGITRETTDLLHKVNRLTEDIQGKVDRLNSVVDAVKGIGDSVQTLNSSVDRVTNSITHNISQNEDKISQVVQWSNVAMEIADKWQNRHYRRGSANYKANNVATDANHSYTSRVDK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1] [2] [3]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  3. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]