Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_1632 [new locus tag: NWMN_RS09170 ]
- pan locus tag?: SAUPAN004406000
- symbol: NWMN_1632
- pan gene symbol?: facZ
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_1632 [new locus tag: NWMN_RS09170 ]
- symbol: NWMN_1632
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1818057..1818548
- length: 492
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330957 NCBI
- RefSeq: YP_001332666 NCBI
- BioCyc:
- MicrobesOnline: 3707184 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGATTGGATTTTACCAATTGCTGGAATTATCGCTGCGATTGCATTCTTAATTTTATGT
ATCGGTATCGTAGCTGTATTAAATTCTGTTAAGAAAAACTTAGATTATGTTGCAAAAACA
CTTGACGGTGTAGAAGGTCAAGTTCAAGGTATTACTCGTGAAACAACAGATTTACTTCAT
AAAGTAAACCGTTTAACTGAGGATATCCAAGGTAAAGTAGATCGTTTAAACTCAGTTGTA
GATGCTGTTAAAGGTATCGGTGACTCAGTACAAACGTTAAACAGCTCTGTAGATCGTGTA
ACAAATTCAATTACACATAATATTTCTCAAAATGAAGATAAAATCTCACAAGTTGTTCAA
TGGTCAAATGTTGCAATGGAAATTGCAGACAAATGGCAAAATAGACACTACCGTCGTGGA
AGTGCAAATTACAAAGCTAATAATGTAGCAACTGATGCAAATCATAGCTATACTTCTAGA
GTAGATAAATAA60
120
180
240
300
360
420
480
492
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_1632 [new locus tag: NWMN_RS09170 ]
- symbol: NWMN_1632
- description: hypothetical protein
- length: 163
- theoretical pI: 7.67054
- theoretical MW: 18002.2
- GRAVY: -0.220245
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis virulence factor Mce family protein (TIGR00996; HMM-score: 33)and 7 moreCellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.3)helix-rich protein (TIGR04523; HMM-score: 14.1)Transport and binding proteins Unknown substrate transport protein (TIGR00833; HMM-score: 13.5)Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 13.5)two transmembrane protein (TIGR04527; HMM-score: 10.8)
- TheSEED :
- UPF0478 protein YtxG
- PFAM: no clan defined DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 103.1)and 44 moreTPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 26.9)no clan defined DUF7310; Coiled-coil region of unknown function (DUF7310) (PF23991; HMM-score: 26)Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 22.5)Concanavalin (CL0004) Laminin_II; Laminin Domain II (PF06009; HMM-score: 21.3)no clan defined Focal_AT; Focal adhesion targeting region (PF03623; HMM-score: 19.6)HsbA; Hydrophobic surface binding protein A (PF12296; HMM-score: 18.5)TPR (CL0020) Sec10_N; Exocyst complex component Sec10, N-terminal (PF20667; HMM-score: 17.9)NUDIX (CL0261) NUDIX_5; NUDIX, or N-terminal NPxY motif-rich, region of KRIT (PF16705; HMM-score: 17.7)no clan defined Gp58; gp58-like protein (PF07902; HMM-score: 16.8)Chlorosome_CsmC; Chlorosome envelope protein C (PF11098; HMM-score: 16.6)BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 16.3)FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 16.1)Mce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 16.1)DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 16)MCPsignal; Methyl-accepting chemotaxis protein (MCP) signalling domain (PF00015; HMM-score: 15.9)BORCS6; BLOC-1-related complex sub-unit 6 C-terminal helix (PF10157; HMM-score: 15.8)NPV_P10; Nucleopolyhedrovirus P10 protein (PF05531; HMM-score: 15.7)TPR (CL0020) COG3_N; Conserved oligomeric Golgi complex subunit 3, N-terminal (PF04136; HMM-score: 15.6)no clan defined Tweety; Tweety (PF04906; HMM-score: 15.6)Ferritin (CL0044) DUF2383; Domain of unknown function (DUF2383) (PF09537; HMM-score: 15.6)STAND_N (CL0587) SesA; N-terminal domain on NACHT_NTPase and P-loop NTPases (PF17107; HMM-score: 15.4)no clan defined BORCS8; BLOC-1-related complex sub-unit 8 (PF10167; HMM-score: 14.6)DUF7217; Domain of unknown function (DUF7217) (PF23854; HMM-score: 14.6)Fzo_mitofusin; fzo-like conserved region (PF04799; HMM-score: 14.4)UPF0184; Uncharacterised protein family (UPF0184) (PF03670; HMM-score: 14.3)DUF16; Protein of unknown function DUF16 (PF01519; HMM-score: 14.2)Prominin; Prominin (PF05478; HMM-score: 14.1)Spectrin (CL0743) Spectrin_Anc-1; Nuclear anchorage protein 1, spectrin-like repeat (PF24611; HMM-score: 14)no clan defined Laminin_I; Laminin Domain I (PF06008; HMM-score: 13.9)PDDEXK (CL0236) RmuC; RmuC family (PF02646; HMM-score: 13.8)Apolipoprotein (CL0725) ApoLp-III; Apolipophorin-III precursor (apoLp-III) (PF07464; HMM-score: 13.8)no clan defined BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 13.6)TPR (CL0020) COG4_N; Conserved oligomeric Golgi complex subunit 4, N-terminal (PF20663; HMM-score: 13.4)no clan defined AI-2E_transport; AI-2E family transporter (PF01594; HMM-score: 13.2)TPR (CL0020) COG5_N; Conserved oligomeric Golgi complex subunit 5, N-terminal (PF10392; HMM-score: 13.2)no clan defined DUF4446; Protein of unknown function (DUF4446) (PF14584; HMM-score: 12.9)TPR (CL0020) EXOC6_Sec15_N; Exocyst complex component EXOC6/Sec15, N-terminal (PF20651; HMM-score: 12.8)no clan defined DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 12.7)DUF6674; Family of unknown function (DUF6674) (PF20379; HMM-score: 12.7)DivIVA; DivIVA protein (PF05103; HMM-score: 12.4)Cluap1; Clusterin-associated protein-1 (PF10234; HMM-score: 12.3)SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 12.1)E-set (CL0159) DUF4179; Domain of unknown function (DUF4179) (PF13786; HMM-score: 11.2)no clan defined GP41; Retroviral envelope protein (PF00517; HMM-score: 8.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0103
- Cytoplasmic Membrane Score: 0.9886
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0009
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.089509
- TAT(Tat/SPI): 0.00082
- LIPO(Sec/SPII): 0.071432
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDWILPIAGIIAAIAFLILCIGIVAVLNSVKKNLDYVAKTLDGVEGQVQGITRETTDLLHKVNRLTEDIQGKVDRLNSVVDAVKGIGDSVQTLNSSVDRVTNSITHNISQNEDKISQVVQWSNVAMEIADKWQNRHYRRGSANYKANNVATDANHSYTSRVDK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
NWMN_1483 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_0959 (phdA) pyruvate dehydrogenase E1 component, alpha subunit [1] (data from MRSA252) NWMN_0960 (phdB) pyruvate dehydrogenase E1 component, beta subunit [1] (data from MRSA252) NWMN_1592 (pykA) pyruvate kinase [1] (data from MRSA252) NWMN_0500 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_2152 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_1326 (sucA) 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)