Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001734
- pan locus tag?: SAUPAN004411000
- symbol: JSNZ_001734
- pan gene symbol?: —
- synonym:
- product: thioredoxin family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001734
- symbol: JSNZ_001734
- product: thioredoxin family protein
- replicon: chromosome
- strand: -
- coordinates: 1781022..1781333
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGATAAATTTATGGATATT
TGTATTGAAAATGGTATTATGGGTATTCCAAGTTTTCTAGTATATAAAAATGGAGAACTG
CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
CAATACGTGTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001734
- symbol: JSNZ_001734
- description: thioredoxin family protein
- length: 103
- theoretical pI: 4.14259
- theoretical MW: 11855.5
- GRAVY: -0.168932
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 47.6)and 6 moreprotein disulfide isomerase (TIGR01130; HMM-score: 26.4)Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 59.3)and 6 moreThioredoxin_9; Thioredoxin (PF14595; HMM-score: 25.3)Phosducin; Phosducin (PF02114; HMM-score: 16.2)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15.2)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 14.9)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 12.9)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9735
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0251
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013564
- TAT(Tat/SPI): 0.002238
- LIPO(Sec/SPII): 0.007556
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.