From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1690 [new locus tag: SAUSA300_RS09235 ]
  • pan locus tag?: SAUPAN004411000
  • symbol: SAUSA300_1690
  • pan gene symbol?:
  • synonym:
  • product: putative thioredoxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1690 [new locus tag: SAUSA300_RS09235 ]
  • symbol: SAUSA300_1690
  • product: putative thioredoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1865026..1865337
  • length: 312
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
    GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
    GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGATAAATTTATGGATATT
    TGTATTGAAAATGGTATTATGGGTATTCCAAGTTTTCTAGTATATAAAAATGGAGAACTG
    CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
    CAATACGTGTAA
    60
    120
    180
    240
    300
    312

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1690 [new locus tag: SAUSA300_RS09235 ]
  • symbol: SAUSA300_1690
  • description: putative thioredoxin
  • length: 103
  • theoretical pI: 4.14259
  • theoretical MW: 11855.5
  • GRAVY: -0.168932

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 47.6)
    and 6 more
    protein disulfide isomerase (TIGR01130; HMM-score: 26.4)
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
  • TheSEED  :
    • Thioredoxin-like protein YtpP
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 58.1)
    and 6 more
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 23.9)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 17.6)
    Phosducin; Phosducin (PF02114; HMM-score: 16.2)
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 15.3)
    Thioredoxin_4; Thioredoxin (PF13462; HMM-score: 12.5)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013564
    • TAT(Tat/SPI): 0.002238
    • LIPO(Sec/SPII): 0.007556
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SAUSA300_2142(asp23)alkaline shock protein 23  [1] (data from MRSA252)
    SAUSA300_1540(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    SAUSA300_0760(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    SAUSA300_1362(hup)DNA-binding protein HU  [1] (data from MRSA252)
    SAUSA300_1644(pyk)pyruvate kinase  [1] (data from MRSA252)
    SAUSA300_2201(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SAUSA300_1603(rplU)50S ribosomal protein L21  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]