From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04955 [old locus tag: NWMN_0885 ]
  • pan locus tag?: SAUPAN003192000
  • symbol: NWMN_RS04955
  • pan gene symbol?:
  • synonym: JSNZ_000974
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS04955 [old locus tag: NWMN_0885 ]
  • symbol: NWMN_RS04955
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 981869..982378
  • length: 510
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (981869..982378) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0885

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGATTTTAGGATTAGCATTAATTCCATCAAAGTCATTTCAAGAAGCGGTGGATTCTTAC
    CGTAAAAGATATGATAAACAGTATTCACGAATTAAACCACATGTGACAATTAAAGCGCCA
    TTTGAAATTAAAGATGGTGATTTAGATTCTGTCATTGAACAGGTTAGAGCTCGTATTAAT
    GGTATACCAGCAGTAGAAGTTCATGCTACAAAAGCTTCTAGCTTCAAACCAACGAACAAT
    GTGATTTACTTTAAAGTTGCGAAGACGGACGACTTAGAAGAATTGTTTAATCGCTTTAAT
    GGAGAAGATTTCTATGGAGAAGCTGAACATGTTTTTGTGCCACACTTTACAATAGCACAA
    GGACTATCTAGCCAAGAATTCGAAGATATTTTTGGTCAAGTAGCATTAGCTGGGGTAGAC
    CATAAAGAAATTATCGATGAATTAACTTTGTTACGTTTTGACGATGACGAAGATAAATGG
    AAAGTTATTGAAACGTTTAAATTAGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    510

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS04955 [old locus tag: NWMN_0885 ]
  • symbol: NWMN_RS04955
  • description: hypothetical protein
  • length: 169
  • theoretical pI: 4.81578
  • theoretical MW: 19325.7
  • GRAVY: -0.313609

Function[edit | edit source]

  • reaction:
    EC 3.1.-.-?  ExPASy
  • TIGRFAM:
    Genetic information processing Transcription RNA processing 2'-5' RNA ligase (TIGR02258; EC 6.5.1.-; HMM-score: 15.8)
    and 1 more
    putative phosphonate metabolism protein (TIGR03223; HMM-score: 12.5)
  • TheSEED: see NWMN_0885
  • PFAM:
    2H (CL0247) 2_5_RNA_ligase2; 2'-5' RNA ligase superfamily (PF13563; HMM-score: 77.9)
    and 5 more
    LigT_PEase; LigT like Phosphoesterase (PF02834; HMM-score: 48)
    CPDase; Cyclic phosphodiesterase-like protein (PF07823; HMM-score: 18.1)
    no clan defined DUF6707; Family of unknown function (DUF6707) (PF20453; HMM-score: 13.6)
    E-set (CL0159) TarS_C1; TarS beta-glycosyltransferase C-terminal domain 1 (PF18674; HMM-score: 13.3)
    TPR (CL0020) Vps16_C; Vps16, C-terminal region (PF04840; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9795
    • Cytoplasmic Membrane Score: 0.0099
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0104
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013851
    • TAT(Tat/SPI): 0.001013
    • LIPO(Sec/SPII): 0.001567
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MILGLALIPSKSFQEAVDSYRKRYDKQYSRIKPHVTIKAPFEIKDGDLDSVIEQVRARINGIPAVEVHATKASSFKPTNNVIYFKVAKTDDLEELFNRFNGEDFYGEAEHVFVPHFTIAQGLSSQEFEDIFGQVALAGVDHKEIIDELTLLRFDDDEDKWKVIETFKLA

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    NWMN_RS0291550S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_RS02965elongation factor Tu  [1] (data from MRSA252)
    NWMN_RS04195aldehyde dehydrogenase  [1] (data from MRSA252)
    NWMN_RS04385glycine cleavage system protein H  [1] (data from MRSA252)
    NWMN_RS05380pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    NWMN_RS05390dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS05395dihydrolipoyl dehydrogenase  [1] (data from MRSA252)
    NWMN_RS0649050S ribosomal protein L19  [1] (data from MRSA252)
    NWMN_RS07455dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex  [1] (data from MRSA252)
    NWMN_RS08930pyruvate kinase  [1] (data from MRSA252)
    NWMN_RS12080Asp23/Gls24 family envelope stress response protein  [1] (data from MRSA252)
    NWMN_RS1234030S ribosomal protein S5  [1] (data from MRSA252)
    NWMN_RS1238030S ribosomal protein S17  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]