Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS12340 [old locus tag: NWMN_2135 ]
- pan locus tag?: SAUPAN005685000
- symbol: NWMN_RS12340
- pan gene symbol?: rpsE
- synonym:
- product: 30S ribosomal protein S5
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS12340 [old locus tag: NWMN_2135 ]
- symbol: NWMN_RS12340
- product: 30S ribosomal protein S5
- replicon: chromosome
- strand: -
- coordinates: 2367331..2367822
- length: 492
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGCTCGTAGAGAAGAAGAGACGAAAGAATTTGAAGAACGCGTTGTTACAATCAACCGT
GTAGCAAAAGTTGTAAAAGGTGGTCGTCGTTTCCGTTTCACTGCATTAGTTGTAGTTGGA
GACAAAAATGGTCGTGTAGGTTTCGGTACTGGTAAAGCTCAAGAGGTACCAGAAGCAATC
AAAAAAGCTGTTGAAGCAGCTAAAAAAGATTTAGTAGTTGTTCCACGTGTTGAAGGTACA
ACTCCACACACAATTACTGGCCGTTACGGTTCAGGAAGCGTATTTATGAAACCGGCTGCA
CCTGGTACAGGAGTTATCGCTGGTGGTCCTGTTCGTGCCGTACTTGAATTAGCAGGTATC
ACTGATATCTTAAGTAAATCATTAGGATCAAACACACCAATCAACATGGTTCGTGCTACA
ATCGATGGTTTACAAAACCTTAAAAATGCTGAAGATGTTGCGAAATTACGTGGCAAAACA
GTAGAAGAATAA60
120
180
240
300
360
420
480
492
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS12340 [old locus tag: NWMN_2135 ]
- symbol: NWMN_RS12340
- description: 30S ribosomal protein S5
- length: 163
- theoretical pI: 10.6781
- theoretical MW: 17351.9
- GRAVY: -0.20184
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01021; HMM-score: 233.6)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS5 (TIGR01020; HMM-score: 108.5)
- TheSEED: see NWMN_2135
- PFAM: S5 (CL0329) Ribosomal_S5_C; Ribosomal protein S5, C-terminal domain (PF03719; HMM-score: 112.5)DSRM (CL0196) Ribosomal_S5; Ribosomal protein S5, N-terminal domain (PF00333; HMM-score: 103.3)and 1 moreMaf (CL0269) NTPase_I-T; Protein of unknown function DUF84 (PF01931; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9246
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0742
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010797
- TAT(Tat/SPI): 0.009728
- LIPO(Sec/SPII): 0.00158
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MARREEETKEFEERVVTINRVAKVVKGGRRFRFTALVVVGDKNGRVGFGTGKAQEVPEAIKKAVEAAKKDLVVVPRVEGTTPHTITGRYGSGSVFMKPAAPGTGVIAGGPVRAVLELAGITDILSKSLGSNTPINMVRATIDGLQNLKNAEDVAKLRGKTVEE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]