From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05970 [old locus tag: NWMN_1057 ]
  • pan locus tag?: SAUPAN003383000
  • symbol: NWMN_RS05970
  • pan gene symbol?: trxA
  • synonym:
  • product: thiol reductase thioredoxin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05970 [old locus tag: NWMN_1057 ]
  • symbol: NWMN_RS05970
  • product: thiol reductase thioredoxin
  • replicon: chromosome
  • strand: +
  • coordinates: 1161779..1162093
  • length: 315
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1161779..1162093) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1057

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGCAATCGTAAAAGTAACAGATGCAGATTTTGATTCAAAAGTAGAATCTGGTGTACAA
    CTAGTAGATTTTTGGGCAACATGGTGTGGTCCATGTAAAATGATCGCTCCGGTATTAGAA
    GAATTAGCAGCTGACTATGAAGGTAAAGCTGACATTTTAAAATTAGATGTTGATGAAAAT
    CCATCAACTGCAGCTAAATATGAAGTGATGAGTATTCCAACATTAATCGTCTTTAAAGAC
    GGTCAACCAGTTGATAAAGTTGTTGGTTTCCAACCAAAAGAAAACTTAGCTGAAGTTTTA
    GATAAACATTTATAA
    60
    120
    180
    240
    300
    315


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_RS05970 [old locus tag: NWMN_1057 ]
  • symbol: NWMN_RS05970
  • description: thiol reductase thioredoxin
  • length: 104
  • theoretical pI: 4.14487
  • theoretical MW: 11440.1
  • GRAVY: 0.0288462

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 132.2)
    and 9 more
    Genetic information processing Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 65.5)
    protein disulfide isomerase (TIGR01130; HMM-score: 56.6)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 34.4)
    Genetic information processing Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 31.6)
    glutaredoxin-like domain protein (TIGR02187; HMM-score: 24.2)
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 22.3)
    glutaredoxin-like protein (TIGR02200; HMM-score: 22.1)
    Metabolism Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 14.9)
    type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
  • TheSEED: see NWMN_1057
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 115.4)
    and 13 more
    Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 37.9)
    Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 33.4)
    Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 24.8)
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 23.7)
    AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 21.8)
    KaiB; KaiB domain (PF07689; HMM-score: 20.3)
    Redoxin; Redoxin (PF08534; HMM-score: 19.4)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 19.1)
    OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 18.4)
    TraF; F plasmid transfer operon protein (PF13728; HMM-score: 16.5)
    HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 16.1)
    DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 13.8)
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 13.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9468
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0527
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.01275
    • TAT(Tat/SPI): 0.000543
    • LIPO(Sec/SPII): 0.001187
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]