Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS12425 [old locus tag: NWMN_2152 ]
- pan locus tag?: SAUPAN005702000
- symbol: NWMN_RS12425
- pan gene symbol?: rplC
- synonym:
- product: 50S ribosomal protein L3
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS12425 [old locus tag: NWMN_2152 ]
- symbol: NWMN_RS12425
- product: 50S ribosomal protein L3
- replicon: chromosome
- strand: -
- coordinates: 2374869..2375531
- length: 663
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGACCAAAGGAATCTTAGGAAGAAAAATTGGGATGACACAAGTATTCGGAGAAAACGGT
GAATTAATCCCTGTAACAGTAGTAGAAGCTAAAGAAAATGTTGTATTACAAAAGAAAACT
GTAGAAGTTGATGGATACAACGCAATCCAAGTTGGATTTGAAGACAAAAAAGCATACAAA
AAAGATGCAAAATCTAATAAATATGCTAATAAACCAGCTGAAGGTCACGCTAAAAAAGCT
GACGCAGCACCTAAGCGCTTCATTCGTGAATTCCGCAATGTAGACGTGGATGCTTACGAA
GTAGGTCAAGAAGTCTCAGTAGATACTTTTGTAGCTGGCGACGTTATTGACGTAACAGGC
GTATCAAAAGGTAAAGGTTTCCAAGGTGCAATTAAACGCCACGGACAATCTCGTGGACCT
ATGTCACACGGTTCTCATTTCCACAGAGCACCAGGTTCTGTAGGTATGGCTTCAGATGCT
TCTAGAGTATTTAAAGGCCAAAAAATGCCAGGACGTATGGGTGGAAACACTGTAACTGTT
CAAAACTTAGAAGTAGTTCAAGTTGACACAGAAAACAAAGTTATCTTAGTAAAAGGTAAC
GTACCTGGACCTAAAAAAGGTTTAGTAGAAATCAGAACTTCAATTAAAAAAGGTAATAAA
TAA60
120
180
240
300
360
420
480
540
600
660
663
⊟Protein[edit | edit source]
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: NWMN_RS12425 [old locus tag: NWMN_2152 ]
- symbol: NWMN_RS12425
- description: 50S ribosomal protein L3
- length: 220
- theoretical pI: 10.5024
- theoretical MW: 23718
- GRAVY: -0.508636
⊟Function[edit | edit source]
- TIGRFAM: 50S ribosomal protein uL3 (TIGR03625; HMM-score: 278)and 1 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL3 (TIGR03626; HMM-score: 54.6)
- TheSEED: see NWMN_2152
- PFAM: ALR_C-like (CL0866) Ribosomal_L3; Ribosomal protein L3 (PF00297; HMM-score: 59.9)and 1 moreE-set (CL0159) DUF3244; Domain of unknown function (DUF3244) (PF11589; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.1611
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.8388
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.020628
- TAT(Tat/SPI): 0.000459
- LIPO(Sec/SPII): 0.001225
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQVGFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEVGQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGSHFHRAPGSVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNVPGPKKGLVEIRTSIKKGNK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_RS02020 30S ribosomal protein S6 [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS02935 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_RS02955 30S ribosomal protein S7 [1] (data from MRSA252) NWMN_RS03640 LysR family transcriptional regulator [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06665 30S ribosomal protein S15 [1] (data from MRSA252) NWMN_RS07785 DNA-binding protein HU [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08830 translation initiation factor IF-3 [1] (data from MRSA252) NWMN_RS08970 universal stress protein [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS09165 hypothetical protein [1] (data from MRSA252) NWMN_RS11395 RNA polymerase sigma factor SigB [1] (data from MRSA252) NWMN_RS11735 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) NWMN_RS12260 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_RS12290 50S ribosomal protein L17 [1] (data from MRSA252) NWMN_RS12295 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) NWMN_RS12300 30S ribosomal protein S11 [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_RS12340 30S ribosomal protein S5 [1] (data from MRSA252) NWMN_RS12350 50S ribosomal protein L6 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12380 30S ribosomal protein S17 [1] (data from MRSA252) NWMN_RS12385 50S ribosomal protein L29 [1] (data from MRSA252) NWMN_RS12390 50S ribosomal protein L16 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_RS12410 50S ribosomal protein L2 [1] (data from MRSA252) NWMN_RS12415 50S ribosomal protein L23 [1] (data from MRSA252) NWMN_RS12420 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_RS12665 transcriptional regulator [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)