From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • pan locus tag?: SAUPAN003853000
  • symbol: NWMN_RS07515
  • pan gene symbol?: crr
  • synonym:
  • product: glucose-specific phosphotransferase enzyme IIA component

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • symbol: NWMN_RS07515
  • product: glucose-specific phosphotransferase enzyme IIA component
  • replicon: chromosome
  • strand: -
  • coordinates: 1467560..1468060
  • length: 501
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1467560..1468060) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1333

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGTTTAAAAAATTATTCGGAAAAGGCAAAGAAGTTCAGAAAGATATCGCAATTTATGCA
    CCATTAACTGGAGAATTCGTGAAAATTGAAGATATTCCAGATCCTGTATTCGCACAAAAA
    ATGATGGGCGAAGGTTTTGGTATTAATCCAACTGAAGGAGAAGTTGTGTCTCCAATTGCA
    GGACGTGTTGACAATGTCTTTCCAACTAAGCATGCGATTGGGTTAAAAGCAGATAACGGA
    TTAGAATTATTAGTTCATATCGGTTTAGACACAGTTCAATTAGACGGTGAAGGATTTGAA
    GTGTTAGTGTCTAGTGGTGACGAAGTTAACGTCGGAGATCCATTAGTAAGATTCAACCTT
    GAATATATTAATAATAACGCTAAATCTGTAATTTCACCAATTATAATTACTAACACTGAT
    CAAGCAGCTTCAATTAATATTTATGATGAAAATGCTGTGATTAAAGGTGAAACAAAAGTG
    ATTGATGTGACAATGAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    501

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS07515 [old locus tag: NWMN_1333 ]
  • symbol: NWMN_RS07515
  • description: glucose-specific phosphotransferase enzyme IIA component
  • length: 166
  • theoretical pI: 4.26969
  • theoretical MW: 17960.4
  • GRAVY: 0.0162651

Function[edit | edit source]

  • TIGRFAM:
    PTS system, beta-glucoside-specific IIABC component (TIGR01995; EC 2.7.1.69; HMM-score: 179.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 152.3)
    Signal transduction Signal transduction PTS PTS system, glucose subfamily, IIA component (TIGR00830; HMM-score: 152.3)
  • TheSEED: see NWMN_1333
  • PFAM:
    Hybrid (CL0105) PTS_EIIA_1; phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 1 (PF00358; HMM-score: 178.9)
    and 3 more
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 17.4)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 13.5)
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 13.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9946
    • Cytoplasmic Membrane Score: 0.004
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0013
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011295
    • TAT(Tat/SPI): 0.000458
    • LIPO(Sec/SPII): 0.000836
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFKKLFGKGKEVQKDIAIYAPLTGEFVKIEDIPDPVFAQKMMGEGFGINPTEGEVVSPIAGRVDNVFPTKHAIGLKADNGLELLVHIGLDTVQLDGEGFEVLVSSGDEVNVGDPLVRFNLEYINNNAKSVISPIIITNTDQAASINIYDENAVIKGETKVIDVTMN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]