Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1171 [new locus tag: SA_RS06655 ]
- pan locus tag?: SAUPAN003709000
- symbol: rpsN
- pan gene symbol?: rpsN2
- synonym:
- product: 30S ribosomal protein S14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1171 [new locus tag: SA_RS06655 ]
- symbol: rpsN
- product: 30S ribosomal protein S14
- replicon: chromosome
- strand: +
- coordinates: 1334310..1334579
- length: 270
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124008 NCBI
- RefSeq: NP_374450 NCBI
- BioCyc: see SA_RS06655
- MicrobesOnline: 103476 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCTAAGAAATCTAAAATAGCAAAAGAGAGAAAAAGAGAAGAGTTAGTAAATAAATAT
TACGAATTACGTAAAGAGTTAAAAGCAAAAGGTGATTACGAAGCGTTAAGAAAATTACCA
AGAGATTCATCACCTACACGTTTAACTAGAAGATGTAAAGTAACTGGAAGACCTAGAGGT
GTATTACGTAAATTTGAAATGTCTCGTATTGCGTTTAGAGAACATGCGCACAAAGGACAA
ATTCCAGGTGTTAAAAAATCAAGTTGGTAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1171 [new locus tag: SA_RS06655 ]
- symbol: RpsN
- description: 30S ribosomal protein S14
- length: 89
- theoretical pI: 11.4256
- theoretical MW: 10540.3
- GRAVY: -1.18989
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- SSU ribosomal protein S14p (S29e)
- SSU ribosomal protein S14p (S29e), zinc-independent
- PFAM: Tbcl_zf (CL0839) Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 98)and 2 moreno clan defined MTR4-like_stalk; Exosome RNA helicase MTR4-like, stalk (PF21408; HMM-score: 13.3)TBD; TBD domain (PF12845; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6669
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3329
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013347
- TAT(Tat/SPI): 0.00948
- LIPO(Sec/SPII): 0.00334
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA1533 (ackA) acetate kinase [1] (data from MRSA252) SA2427 (arcB) ornithine carbamoyltransferase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1184 (citB) aconitate hydratase [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0545 (eutD) phosphotransacetylase [1] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [1] (data from MRSA252) SA1553 (fhs) formate--tetrahydrofolate ligase [1] (data from MRSA252) SA1028 (ftsA) cell division protein [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [1] (data from MRSA252) SA1836 (groEL) molecular chaperone GroEL [1] (data from MRSA252) SA0376 (guaA) GMP synthase [1] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [1] (data from MRSA252) SA1305 (hu) DNA-binding protein II [1] (data from MRSA252) SA1504 (infC) translation initiation factor IF-3 [1] (data from MRSA252) SA0232 (lctE) L-lactate dehydrogenase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [1] (data from MRSA252) SA0943-1 (pdhA) pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA0496 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA2033 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [1] (data from MRSA252) SA2040 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [1] (data from MRSA252) SA1084 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SA1473 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SA1503 (rpmI) 50S ribosomal protein L35 [1] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA0352 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SA0504 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA2024 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SA2025 (rpsM) 30S ribosomal protein S13 [1] (data from MRSA252) SA1116 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SA2038 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SA0354 (rpsR) 30S ribosomal protein S18 [1] (data from MRSA252) SA2043 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SA1414 (rpsT) 30S ribosomal protein S20 [1] (data from MRSA252) SA1499 (tig) trigger factor [1] (data from MRSA252) SA0295 hypothetical protein [1] (data from MRSA252) SA0477 pyridoxal biosynthesis lyase PdxS [1] (data from MRSA252) SA0499 hypothetical protein [1] (data from MRSA252) SA0605 dihydroxyacetone kinase subunit DhaK [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0637 hypothetical protein [1] (data from MRSA252) SA0760 glycine cleavage system protein H [1] (data from MRSA252) SA0859 hypothetical protein [1] (data from MRSA252) SA0940 hypothetical protein [1] (data from MRSA252) SA1118 hypothetical protein [1] (data from MRSA252) SA1443 hypothetical protein [1] (data from MRSA252) SA1528 hypothetical protein [1] (data from MRSA252) SA1709 hypothetical protein [1] (data from MRSA252) SA1745 hypothetical protein [1] (data from MRSA252) SA2399 fructose-1,6-bisphosphate aldolase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: Zur* (repression) regulon
Zur* (TF) important in Zinc homeostasis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)