Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001320
- pan locus tag?: SAUPAN003709000
- symbol: rpsN
- pan gene symbol?: rpsN2
- synonym:
- product: 30S ribosomal protein S14
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001320
- symbol: rpsN
- product: 30S ribosomal protein S14
- replicon: chromosome
- strand: +
- coordinates: 1328043..1328312
- length: 270
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGCTAAGAAATCTAAAATAGCAAAAGAGAGAAAAAGAGAAGAGTTAGTAAATAAATAT
TACGAATTACGTAAAGAGTTAAAAGCAAAAGGTGATTACGAAGCGTTAAGAAAATTACCA
AGAGATTCATCACCTACACGTTTAACTAGAAGATGTAAAGTAACTGGAAGACCTAGAGGT
GTATTACGTAAATTTGAAATGTCTCGTATTGCGTTTAGAGAACATGCGCACAAAGGACAA
ATTCCAGGTGTTAAAAAATCAAGTTGGTAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001320
- symbol: RpsN
- description: 30S ribosomal protein S14
- length: 89
- theoretical pI: 11.4256
- theoretical MW: 10540.3
- GRAVY: -1.18989
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: Tbcl_zf (CL0839) Ribosomal_S14; Ribosomal protein S14p/S29e (PF00253; HMM-score: 98)and 2 moreno clan defined MTR4-like_stalk; Exosome RNA helicase MTR4-like, stalk (PF21408; HMM-score: 13.3)TBD; TBD domain (PF12845; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6669
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3329
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013347
- TAT(Tat/SPI): 0.00948
- LIPO(Sec/SPII): 0.00334
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKKSKIAKERKREELVNKYYELRKELKAKGDYEALRKLPRDSSPTRLTRRCKVTGRPRGVLRKFEMSRIAFREHAHKGQIPGVKKSSW
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
Curr Res Microb Sci: 2025, 9;100489
[PubMed:41146725] [WorldCat.org] [DOI] (I e)