Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00521
  • pan locus tag?: SAUPAN002311000
  • symbol: rplL
  • pan gene symbol?: rplL
  • synonym:
  • product: 50S ribosomal protein L7/L12

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00521
  • symbol: rplL
  • product: 50S ribosomal protein L7/L12
  • replicon: chromosome
  • strand: +
  • coordinates: 520794..521162
  • length: 369
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3920375 NCBI
  • RefSeq: YP_499094 NCBI
  • BioCyc: G1I0R-492 BioCyc
  • MicrobesOnline: 1289004 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCTAATCATGAACAAATCATTGAAGCGATTAAAGAAATGTCAGTATTAGAATTAAAC
    GACTTAGTAAAAGCAATTGAAGAAGAATTTGGTGTAACTGCAGCTGCTCCAGTAGCAGTA
    GCAGGTGCAGCTGGTGGCGCTGACGCTGCAGCAGAAAAAACTGAATTTGACGTTGAGTTA
    ACTTCAGCTGGTTCATCTAAAATCAAAGTTGTTAAAGCTGTTAAAGAAGCAACTGGTTTA
    GGATTAAAAGATGCTAAAGAATTAGTAGACGGAGCTCCTAAAGTAATCAAAGAAGCTTTA
    CCTAAAGAAGAAGCTGAAAAACTTAAAGAACAATTAGAAGAAGTTGGAGCTACTGTAGAA
    TTAAAATAA
    60
    120
    180
    240
    300
    360
    369

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00521
  • symbol: RplL
  • description: 50S ribosomal protein L7/L12
  • length: 122
  • theoretical pI: 4.32374
  • theoretical MW: 12711.5
  • GRAVY: -0.0483607

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL12 (TIGR00855; HMM-score: 158.6)
  • TheSEED  :
    • LSU ribosomal protein L7p/L12p (P1/P2)
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L7/L12 (P1/P2)
  • ⊞PFAM:
    no clan defined Ribosomal_L12; Ribosomal protein L7/L12 C-terminal domain (PF00542; HMM-score: 104.3)
    and 6 more
    Ribosomal_L12_N; Ribosomal protein L7/L12 dimerisation domain (PF16320; HMM-score: 75.5)
    DUF2267; Uncharacterized conserved protein (DUF2267) (PF10025; HMM-score: 16.3)
    IHF-likeDNA-bdg (CL0548) Bac_DNA_binding; Bacterial DNA-binding protein (PF00216; HMM-score: 15.7)
    no clan defined Ribosomal_60s; 60s Acidic ribosomal protein (PF00428; HMM-score: 15)
    CwsA; Cell wall synthesis protein CwsA (PF10814; HMM-score: 14.5)
    HTH (CL0123) HTH_33; Winged helix-turn helix (PF13592; HMM-score: 12.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9475
    • Cytoplasmic Membrane Score: 0.0177
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0346
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.057639
    • TAT(Tat/SPI): 0.076736
    • LIPO(Sec/SPII): 0.001562
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 88194302 NCBI
  • RefSeq: YP_499094 NCBI
  • UniProt: P48860 UniProt
  • STRING: 93061.SAOUHSC_00521 STRING

⊟Protein sequence[edit | edit source]

  • MANHEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAVAGAAGGADAAAEKTEFDVELTSAGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVGATVELK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • ⊟interaction partners:
    SAOUHSC_01683(dnaK)molecular chaperone DnaK  [4] (data from MRSA252)
    SAOUHSC_00799(eno)phosphopyruvate hydratase  [4] (data from MRSA252)
    SAOUHSC_00796(pgk)phosphoglycerate kinase  [4] (data from MRSA252)
    SAOUHSC_00519(rplA)50S ribosomal protein L1  [4] (data from MRSA252)
    SAOUHSC_02509(rplB)50S ribosomal protein L2  [4] (data from MRSA252)
    SAOUHSC_02512(rplC)50S ribosomal protein L3  [4] (data from MRSA252)
    SAOUHSC_02511(rplD)50S ribosomal protein L4  [4] (data from MRSA252)
    SAOUHSC_02496(rplF)50S ribosomal protein L6  [4] (data from MRSA252)
    SAOUHSC_00520(rplJ)50S ribosomal protein L10  [4] (data from MRSA252)
    SAOUHSC_00518(rplK)50S ribosomal protein L11  [4] (data from MRSA252)
    SAOUHSC_02478(rplM)50S ribosomal protein L13  [4] (data from MRSA252)
    SAOUHSC_02492(rplO)50S ribosomal protein L15  [4] (data from MRSA252)
    SAOUHSC_02495(rplR)50S ribosomal protein L18  [4] (data from MRSA252)
    SAOUHSC_01211(rplS)50S ribosomal protein L19  [4] (data from MRSA252)
    SAOUHSC_01784(rplT)50S ribosomal protein L20  [4] (data from MRSA252)
    SAOUHSC_01757(rplU)50S ribosomal protein L21  [4] (data from MRSA252)
    SAOUHSC_02507(rplV)50S ribosomal protein L22  [4] (data from MRSA252)
    SAOUHSC_02493(rpmD)50S ribosomal protein L30  [4] (data from MRSA252)
    SAOUHSC_00524(rpoB)DNA-directed RNA polymerase subunit beta  [4] (data from MRSA252)
    SAOUHSC_01493(rpsA)30S ribosomal protein S1  [4] (data from MRSA252)
    SAOUHSC_01232(rpsB)30S ribosomal protein S2  [4] (data from MRSA252)
    SAOUHSC_02506(rpsC)30S ribosomal protein S3  [4] (data from MRSA252)
    SAOUHSC_02494(rpsE)30S ribosomal protein S5  [4] (data from MRSA252)
    SAOUHSC_00348(rpsF)30S ribosomal protein S6  [4] (data from MRSA252)
    SAOUHSC_02477(rpsI)30S ribosomal protein S9  [4] (data from MRSA252)
    SAOUHSC_00527(rpsL)30S ribosomal protein S12  [4] (data from MRSA252)
    SAOUHSC_02487(rpsM)30S ribosomal protein S13  [4] (data from MRSA252)
    SAOUHSC_00769(secA)preprotein translocase subunit SecA  [4] (data from MRSA252)
    SAOUHSC_01418(sucA)2-oxoglutarate dehydrogenase E1 component  [4] (data from MRSA252)
    SAOUHSC_00797(tpiA)triosephosphate isomerase  [4] (data from MRSA252)
    SAOUHSC_01234(tsf)elongation factor Ts  [4] (data from MRSA252)
    SAOUHSC_00069protein A  [4] (data from MRSA252)
    SAOUHSC_00187formate acetyltransferase  [4] (data from MRSA252)
    SAOUHSC_002845'-nucleotidase  [4] (data from MRSA252)
    SAOUHSC_00365alkyl hydroperoxide reductase subunit C  [4] (data from MRSA252)
    SAOUHSC_00374inosine-5'-monophosphate dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_00488hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_0052830S ribosomal protein S7  [4] (data from MRSA252)
    SAOUHSC_00529elongation factor G  [4] (data from MRSA252)
    SAOUHSC_00530elongation factor Tu  [4] (data from MRSA252)
    SAOUHSC_00694hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_00795glyceraldehyde-3-phosphate dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_00878hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_00906hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_01029phosphoenolpyruvate-protein phosphotransferase  [4] (data from MRSA252)
    SAOUHSC_01040pyruvate dehydrogenase complex, E1 component subunit alpha  [4] (data from MRSA252)
    SAOUHSC_01041pyruvate dehydrogenase complex, E1 component subunit beta  [4] (data from MRSA252)
    SAOUHSC_01042branched-chain alpha-keto acid dehydrogenase subunit E2  [4] (data from MRSA252)
    SAOUHSC_01043dihydrolipoamide dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_01150cell division protein FtsZ  [4] (data from MRSA252)
    SAOUHSC_01251polynucleotide phosphorylase/polyadenylase  [4] (data from MRSA252)
    SAOUHSC_01337transketolase  [4] (data from MRSA252)
    SAOUHSC_01403cold shock protein  [4] (data from MRSA252)
    SAOUHSC_01416dihydrolipoamide succinyltransferase  [4] (data from MRSA252)
    SAOUHSC_01490DNA-binding protein HU  [4] (data from MRSA252)
    SAOUHSC_01653superoxide dismutase  [4] (data from MRSA252)
    SAOUHSC_01801isocitrate dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_01806pyruvate kinase  [4] (data from MRSA252)
    SAOUHSC_01814hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_01819hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_01820acetate kinase  [4] (data from MRSA252)
    SAOUHSC_01901putative translaldolase  [4] (data from MRSA252)
    SAOUHSC_01908hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_02108ferritin  [4] (data from MRSA252)
    SAOUHSC_02131hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_02377pyrimidine-nucleoside phosphorylase  [4] (data from MRSA252)
    SAOUHSC_02425hypothetical protein  [4] (data from MRSA252)
    SAOUHSC_02441alkaline shock protein 23  [4] (data from MRSA252)
    SAOUHSC_0248630S ribosomal protein S11  [4] (data from MRSA252)
    SAOUHSC_02542molybdopterin biosynthesis protein MoeA  [4] (data from MRSA252)
    SAOUHSC_02760glutamate synthase subunit alpha  [4] (data from MRSA252)
    SAOUHSC_028691-pyrroline-5-carboxylate dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_02922L-lactate dehydrogenase  [4] (data from MRSA252)
    SAOUHSC_02926fructose-1,6-bisphosphate aldolase  [4] (data from MRSA252)
    SAOUHSC_02927malate:quinone oxidoreductase  [4] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: secE > SAOUHSC_00517 > rplK > rplA > rplJ > rplL > SAOUHSC_00523
    predicted SigA promoter [5] : S174 > gltX > S175 > S176 > SAOUHSC_00510 > cysS > SAOUHSC_00512 > SAOUHSC_00513 > SAOUHSC_00514 > S177 > SAOUHSC_00515 > S178 > S179 > secE > SAOUHSC_00517 > S180 > rplK > S181 > rplA > S182 > S183 > rplJ > rplL
    predicted SigA promoter [5] : S179 > secE > SAOUHSC_00517 > S180 > rplK > S181 > rplA > S182 > S183 > rplJ > rplL > S184 > SAOUHSC_00523 > S185 > rpoB > S186 > SAOUHSC_00525
    predicted SigA promoter [5] : S183 > rplJ > rplL > S184 > SAOUHSC_00523 > S185 > rpoB > S186 > SAOUHSC_00525 > SAOUHSC_00526 > S187 > rpsL > SAOUHSC_00528 > S188 > SAOUHSC_00529 > S189 > SAOUHSC_00530

⊟Regulation[edit | edit source]

  • ⊞regulator: L10 leader (transcription termination) regulon
    L10 leader(5' cis-acting region)important in Ribosome biogenesis; transcription unit transferred from N315 data RegPrecise 

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [5] 
    Expression Data Browser
    ⊟Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: data available for COL

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ Jump up to: 4.00 4.01 4.02 4.03 4.04 4.05 4.06 4.07 4.08 4.09 4.10 4.11 4.12 4.13 4.14 4.15 4.16 4.17 4.18 4.19 4.20 4.21 4.22 4.23 4.24 4.25 4.26 4.27 4.28 4.29 4.30 4.31 4.32 4.33 4.34 4.35 4.36 4.37 4.38 4.39 4.40 4.41 4.42 4.43 4.44 4.45 4.46 4.47 4.48 4.49 4.50 4.51 4.52 4.53 4.54 4.55 4.56 4.57 4.58 4.59 4.60 4.61 4.62 4.63 4.64 4.65 4.66 4.67 4.68 4.69 4.70 4.71 4.72 4.73 4.74 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  5. ↑ Jump up to: 5.0 5.1 5.2 5.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

M Aboshkiwa, G Rowland, G Coleman
Nucleotide sequence of the Staphylococcus aureus RNA polymerase rpoB gene and comparison of its predicted amino acid sequence with those of other bacteria.
Biochim Biophys Acta: 1995, 1262(1);73-8
[PubMed:7772603] [WorldCat.org] [DOI] (P p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00521&oldid=98961"
  • This page was last edited on 11 March 2016, at 12:19.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again