Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00510
- pan locus tag?: SAUPAN002297000
- symbol: SAOUHSC_00510
- pan gene symbol?: cysE
- synonym: JSNZ_000486
- product: serine acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID: 3920422 NCBI
- RefSeq: YP_499083 NCBI
- BioCyc: G1I0R-481 BioCyc
- MicrobesOnline: 1288993 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGATCTTGTTAAAAAGAATGAGAGACGATATAAAAATGGTATTTGAGCAGGATCCAGCG
GCACGTTCAACATTAGAAGTCATTACAACGTATGCAGGTTTACATGCAGTTTGGAGTCAT
TTGATTGCACATAAGTTATACAACCAAAAAAAATATGTTGCAGCACGCGCGATATCTCAA
ATTTCAAGATTTTTCACAGGTATAGAAATCCATCCAGGTGCTAAAATTGGAAAGCGTCTA
TTTATAGATCATGGTATGGGCGTTGTAATAGGAGAAACATGTACAATTGGTGATAATGTG
ACAATCTATCAAGGCGTGACACTTGGTGGGACAGGGAAAGAAAGAGGGAAAAGACACCCA
GATATAGGAGACAATGTTTTAATAGCAGCCGGTGCGAAAGTTTTAGGAAATATTAAAATA
AATTCAAATGTAAATATTGGTGCAAATTCAGTTGTTTTACAATCAGTTCCAAGTTATTCA
ACGGTTGTTGGTATACCAGGACATATTGTTAAGCAAGATGGTGTTCGAGTTGGAAAAACA
TTTGATCATCGCCATCTACCTGATCCAATTTATGAACAAATTAAGCATTTAGAACGACAA
CTTGAAAAGACTAGGAATGGAGAGATTCAAGATGATTACATTATATAA60
120
180
240
300
360
420
480
540
600
648
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00510
- symbol: SAOUHSC_00510
- description: serine acetyltransferase
- length: 215
- theoretical pI: 9.85567
- theoretical MW: 23754.2
- GRAVY: -0.156279
⊟Function[edit | edit source]
- reaction: EC 2.3.1.30? ExPASySerine O-acetyltransferase Acetyl-CoA + L-serine = CoA + O-acetyl-L-serine
- TIGRFAM: Amino acid biosynthesis Serine family serine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 250.8)and 13 morecolanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 73.2)sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 56.8)2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 52.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 39.8)phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 31.7)non-ribosomal peptide synthetase terminal domain of unknown function (TIGR02353; HMM-score: 20.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 20.1)colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 17.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 17.5)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03991; EC 2.3.1.157,2.7.7.23; HMM-score: 9.2)
- TheSEED :
- Serine acetyltransferase (EC 2.3.1.30)
Amino Acids and Derivatives Lysine, threonine, methionine, and cysteine Cysteine Biosynthesis Serine acetyltransferase (EC 2.3.1.30)and 2 more - PFAM: HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 55.3)and 5 moreLbH_EIF2B; EIF2B subunit epsilon LbH domain (PF25084; HMM-score: 26.2)Hexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 24)no clan defined SATase_N; Serine acetyltransferase, N-terminal (PF06426; HMM-score: 17.5)NusG_add; NusG additional domain (PF18298; HMM-score: 13.9)HEXAPEP (CL0536) GMPPB_C; GMPPB C-terminal domain (PF25087; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6492
- Cytoplasmic Membrane Score: 0.3274
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0233
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003478
- TAT(Tat/SPI): 0.000756
- LIPO(Sec/SPII): 0.001007
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILLKRMRDDIKMVFEQDPAARSTLEVITTYAGLHAVWSHLIAHKLYNQKKYVAARAISQISRFFTGIEIHPGAKIGKRLFIDHGMGVVIGETCTIGDNVTIYQGVTLGGTGKERGKRHPDIGDNVLIAAGAKVLGNIKINSNVNIGANSVVLQSVPSYSTVVGIPGHIVKQDGVRVGKTFDHRHLPDPIYEQIKHLERQLEKTRNGEIQDDYII
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [2] [3]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_00510 > cysS > SAOUHSC_00512 > SAOUHSC_00513 > SAOUHSC_00514predicted SigA promoter [4] : SAOUHSC_00502 > S169 > SAOUHSC_00503 > SAOUHSC_00504 > SAOUHSC_00505 > S170 > S171 > S172 > SAOUHSC_00507 > SAOUHSC_00508 > S173 > S174 > gltX > S175 > S176 > SAOUHSC_00510predicted SigA promoter [4] : S171 > S172 > SAOUHSC_00507 > SAOUHSC_00508 > S173 > S174 > gltX > S175 > S176 > SAOUHSC_00510 > cysS > SAOUHSC_00512 > SAOUHSC_00513 > SAOUHSC_00514 > S177 > SAOUHSC_00515 > S178 > S179 > secE > SAOUHSC_00517 > S180 > rplK > S181 > rplA > S182predicted SigA promoter [4] : S174 > gltX > S175 > S176 > SAOUHSC_00510 > cysS > SAOUHSC_00512 > SAOUHSC_00513 > SAOUHSC_00514 > S177 > SAOUHSC_00515 > S178 > S179 > secE > SAOUHSC_00517 > S180 > rplK > S181 > rplA > S182 > S183 > rplJ > rplLpredicted SigA promoter [4] : S175 > S176 > SAOUHSC_00510 > cysS > SAOUHSC_00512 > SAOUHSC_00513 > SAOUHSC_00514 > S177 > SAOUHSC_00515 > S178 > S179 > secE > SAOUHSC_00517 > S180 > rplK > S181 > rplA > S182
⊟Regulation[edit | edit source]
- regulator: T-box(Cys) (transcription antitermination) regulon
T-box(Cys) (5' cis-acting region) important in Amino acid metabolism; compare RegPrecise for N315
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
BMC Genomics: 2009, 10;291
[PubMed:19570206] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 4.0 4.1 4.2 4.3 4.4 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
