Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS07770 [old locus tag: NWMN_1380 ]
- pan locus tag?: SAUPAN003931000
- symbol: NWMN_RS07770
- pan gene symbol?: ubiE
- synonym:
- product: demethylmenaquinone methyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS07770 [old locus tag: NWMN_1380 ]
- symbol: NWMN_RS07770
- product: demethylmenaquinone methyltransferase
- replicon: chromosome
- strand: -
- coordinates: 1546717..1547442
- length: 726
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGGCTGACAATAAAGCAAATAAAGAGCAAGTACATCGCGTTTTTCAAAATATTTCAAAA
AAATATGATAGATTAAATAATATTATTAGTTTTGAGCAGCATAAAGTATGGAGAAAACGC
GTCATGAAAGACATGGGTGTTAGAAAAGGGACGAAAGCATTAGATGTTTGTTGTGGTACT
GGTGATTGGACAATCGCATTAAGCAAAGCTGTAGGACCAACAGGTGAAGTTACTGGTATT
GACTTTAGTGAGAATATGTTAGAAGTAGGAAAAGAAAAAACTGCTTCAATGGAAAATGTT
AAACTTGTTCATGGTGATGCAATGGAATTGCCGTTTGAAGACAATTCTTTTGATTATGTA
ACAATTGGGTTTGGATTAAGAAATGTGCCAGACTATTTAGTCGCGTTAAAAGAAATGAAT
AGAGTACTTAAACCAGGTGGTATGGTGGTATGTCTTGAAACGAGCCAACCAACTTTGCCA
GTCTTTAAACAAATGTATGCACTATACTTTAAATTTGTTATGCCTATTTTTGGAAAATTA
TTTGCAAAATCAAAAGAAGAATATGAATGGTTACAGCAATCTACGTTTAATTTTCCTGGA
AAAGAAGAGTTGAAGCGCATGTTTGAAGAAGCAGGTTTCATAAATGTAAGAGTACGTAGT
TTTACAGGGGGCGTTGCTGCAATGCACCTTGGCTATAAAGAAAAAGATAATACCAAAGGT
GATTAA60
120
180
240
300
360
420
480
540
600
660
720
726
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS07770 [old locus tag: NWMN_1380 ]
- symbol: NWMN_RS07770
- description: demethylmenaquinone methyltransferase
- length: 241
- theoretical pI: 9.02909
- theoretical MW: 27422.5
- GRAVY: -0.378838
⊟Function[edit | edit source]
- reaction: EC 2.1.1.163? ExPASyDemethylmenaquinone methyltransferase A demethylmenaquinol + S-adenosyl-L-methionine = a menaquinol + S-adenosyl-L-homocysteine
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 402.2)and 23 moreBiosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 300.9)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 64.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 41.7)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 36.6)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 36.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 31.4)Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 31.3)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30)methyltransferase, FxLD system (TIGR04364; HMM-score: 28.8)Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 27.2)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 23.8)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 23.2)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 21.6)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 20.5)Protein synthesis tRNA and rRNA base modification ribosomal RNA large subunit methyltransferase J (TIGR00438; EC 2.1.1.166; HMM-score: 16.6)Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 15.9)Protein synthesis tRNA and rRNA base modification 23S rRNA (uracil-5-)-methyltransferase RumA (TIGR00479; EC 2.1.1.-; HMM-score: 15.5)Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 15.3)methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 13.6)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 12.7)Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 12.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 11.3)
- TheSEED: see NWMN_1380
- PFAM: NADP_Rossmann (CL0063) Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 328.3)and 21 moreMethyltransf_25; Methyltransferase domain (PF13649; HMM-score: 94.3)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 88.5)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 86.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 63.5)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 59.8)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 39.4)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 36.7)Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 28.2)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 23.1)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.4)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 20.9)GCD14; tRNA methyltransferase complex GCD14 subunit (PF08704; HMM-score: 20.1)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 19.6)MTS; Methyltransferase small domain (PF05175; HMM-score: 19.5)Rsm22; Mitochondrial small ribosomal subunit Rsm22 (PF09243; HMM-score: 18.4)Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 18.2)Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 14.9)Anamorsin_N; Anamorsin, N-terminal (PF20922; HMM-score: 14.5)Methyltr_RsmB-F; 16S rRNA methyltransferase RsmB/F (PF01189; HMM-score: 14.4)Methyltransf_29; Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141; HMM-score: 12.1)Fibrillarin; Fibrillarin (PF01269; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.46
- Cytoplasmic Membrane Score: 0.5206
- Cell wall & surface Score: 0
- Extracellular Score: 0.0194
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.061569
- TAT(Tat/SPI): 0.000665
- LIPO(Sec/SPII): 0.000878
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MADNKANKEQVHRVFQNISKKYDRLNNIISFEQHKVWRKRVMKDMGVRKGTKALDVCCGTGDWTIALSKAVGPTGEVTGIDFSENMLEVGKEKTASMENVKLVHGDAMELPFEDNSFDYVTIGFGLRNVPDYLVALKEMNRVLKPGGMVVCLETSQPTLPVFKQMYALYFKFVMPIFGKLFAKSKEEYEWLQQSTFNFPGKEELKRMFEEAGFINVRVRSFTGGVAAMHLGYKEKDNTKGD
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
NWMN_RS07690 (asnC) asparagine--tRNA ligase [1] (data from MRSA252) NWMN_RS00045 serine--tRNA ligase [1] (data from MRSA252) NWMN_RS00315 peptidoglycan-binding protein LysM [1] (data from MRSA252) NWMN_RS00465 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) NWMN_RS00885 formate acetyltransferase [1] (data from MRSA252) NWMN_RS00980 L-lactate dehydrogenase [1] (data from MRSA252) NWMN_RS01060 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [1] (data from MRSA252) NWMN_RS01375 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) NWMN_RS02105 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) NWMN_RS02135 hypothetical protein [1] (data from MRSA252) NWMN_RS02150 IMP dehydrogenase [1] (data from MRSA252) NWMN_RS02655 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) NWMN_RS02715 cysteine synthase [1] (data from MRSA252) NWMN_RS02910 50S ribosomal protein L11 [1] (data from MRSA252) NWMN_RS02915 50S ribosomal protein L1 [1] (data from MRSA252) NWMN_RS02920 50S ribosomal protein L10 [1] (data from MRSA252) NWMN_RS02925 50S ribosomal protein L7/L12 [1] (data from MRSA252) NWMN_RS02935 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) NWMN_RS02940 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) NWMN_RS02960 elongation factor G [1] (data from MRSA252) NWMN_RS02965 elongation factor Tu [1] (data from MRSA252) NWMN_RS03160 phosphate acetyltransferase [1] (data from MRSA252) NWMN_RS03300 zinc-dependent alcohol dehydrogenase [1] (data from MRSA252) NWMN_RS04075 ribosomal subunit interface protein [1] (data from MRSA252) NWMN_RS04195 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS04200 phosphoglycerate kinase [1] (data from MRSA252) NWMN_RS04205 triose-phosphate isomerase [1] (data from MRSA252) NWMN_RS04215 enolase [1] (data from MRSA252) NWMN_RS04675 NAD-specific glutamate dehydrogenase [1] (data from MRSA252) NWMN_RS04955 hypothetical protein [1] (data from MRSA252) NWMN_RS05380 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) NWMN_RS05385 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) NWMN_RS05390 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) NWMN_RS05395 dihydrolipoyl dehydrogenase [1] (data from MRSA252) NWMN_RS05970 thiol reductase thioredoxin [1] (data from MRSA252) NWMN_RS06210 cell division protein FtsZ [1] (data from MRSA252) NWMN_RS06435 beta-ketoacyl-ACP reductase [1] (data from MRSA252) NWMN_RS06490 50S ribosomal protein L19 [1] (data from MRSA252) NWMN_RS06515 succinyl-CoA ligase subunit beta [1] (data from MRSA252) NWMN_RS06585 elongation factor Ts [1] (data from MRSA252) NWMN_RS06595 ribosome-recycling factor [1] (data from MRSA252) NWMN_RS06645 translation initiation factor IF-2 [1] (data from MRSA252) NWMN_RS06670 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) NWMN_RS06840 glutamine synthetase [1] (data from MRSA252) NWMN_RS07515 glucose-specific phosphotransferase enzyme IIA component [1] (data from MRSA252) NWMN_RS08090 elongation factor P [1] (data from MRSA252) NWMN_RS08350 molecular chaperone DnaK [1] (data from MRSA252) NWMN_RS08675 50S ribosomal protein L27 [1] (data from MRSA252) NWMN_RS08685 50S ribosomal protein L21 [1] (data from MRSA252) NWMN_RS08790 ATP-dependent Clp protease ATP-binding subunit ClpX [1] (data from MRSA252) NWMN_RS08795 trigger factor [1] (data from MRSA252) NWMN_RS08840 threonine--tRNA ligase [1] (data from MRSA252) NWMN_RS08865 aldehyde dehydrogenase [1] (data from MRSA252) NWMN_RS08905 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) NWMN_RS08930 pyruvate kinase [1] (data from MRSA252) NWMN_RS08935 ATP-dependent 6-phosphofructokinase [1] (data from MRSA252) NWMN_RS09000 acetate kinase [1] (data from MRSA252) NWMN_RS09045 30S ribosomal protein S4 [1] (data from MRSA252) NWMN_RS09125 formate--tetrahydrofolate ligase [1] (data from MRSA252) NWMN_RS09225 D-alanine aminotransferase [1] (data from MRSA252) NWMN_RS09230 dipeptidase PepV [1] (data from MRSA252) NWMN_RS10570 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C [1] (data from MRSA252) NWMN_RS11175 molecular chaperone GroEL [1] (data from MRSA252) NWMN_RS11180 co-chaperone GroES [1] (data from MRSA252) NWMN_RS11655 uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_RS11715 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) NWMN_RS11720 fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS11735 DNA-directed RNA polymerase subunit delta [1] (data from MRSA252) NWMN_RS11875 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) NWMN_RS12080 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) NWMN_RS12260 30S ribosomal protein S9 [1] (data from MRSA252) NWMN_RS12295 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) NWMN_RS12330 50S ribosomal protein L15 [1] (data from MRSA252) NWMN_RS12345 50S ribosomal protein L18 [1] (data from MRSA252) NWMN_RS12355 30S ribosomal protein S8 [1] (data from MRSA252) NWMN_RS12365 50S ribosomal protein L5 [1] (data from MRSA252) NWMN_RS12370 50S ribosomal protein L24 [1] (data from MRSA252) NWMN_RS12395 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_RS12400 50S ribosomal protein L22 [1] (data from MRSA252) NWMN_RS12420 50S ribosomal protein L4 [1] (data from MRSA252) NWMN_RS12425 50S ribosomal protein L3 [1] (data from MRSA252) NWMN_RS12430 30S ribosomal protein S10 [1] (data from MRSA252) NWMN_RS14105 L-glutamate gamma-semialdehyde dehydrogenase [1] (data from MRSA252) NWMN_RS14365 class I fructose-bisphosphate aldolase [1] (data from MRSA252) NWMN_RS14370 malate:quinone oxidoreductase [1] (data from MRSA252) NWMN_RS14555 ornithine carbamoyltransferase [1] (data from MRSA252) NWMN_RS14560 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 1.66 1.67 1.68 1.69 1.70 1.71 1.72 1.73 1.74 1.75 1.76 1.77 1.78 1.79 1.80 1.81 1.82 1.83 1.84 1.85 1.86 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)