From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08675 [old locus tag: NWMN_1547 ]
  • pan locus tag?: SAUPAN004251000
  • symbol: NWMN_RS08675
  • pan gene symbol?: rpmA
  • synonym:
  • product: 50S ribosomal protein L27

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08675 [old locus tag: NWMN_1547 ]
  • symbol: NWMN_RS08675
  • product: 50S ribosomal protein L27
  • replicon: chromosome
  • strand: -
  • coordinates: 1715370..1715654
  • length: 285
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_009641 (1715370..1715654) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1547

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTTAAAATTAAACTTACAATTCTTCGCATCTAAAAAAGGGGTAAGTTCTACAAAAAAC
    GGACGTGACTCTGAATCAAAACGCTTAGGTGCTAAACGTGCTGACGGTCAATTCGTAACA
    GGTGGTTCAATTTTATATCGCCAACGTGGTACTAAAATTTACCCTGGTGAAAATGTAGGT
    CGTGGTGGCGATGATACATTATTCGCTAAAATCGACGGCGTTGTTAAATTCGAACGTAAA
    GGTCGCGACAAAAAACAAGTTTCTGTATATGCAGTAGCTGAATAA
    60
    120
    180
    240
    285

⊟Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: NWMN_RS08675 [old locus tag: NWMN_1547 ]
  • symbol: NWMN_RS08675
  • description: 50S ribosomal protein L27
  • length: 94
  • theoretical pI: 10.8424
  • theoretical MW: 10314.7
  • GRAVY: -0.689362

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL27 (TIGR00062; HMM-score: 132.7)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined Ribosomal_L27; Ribosomal L27 protein (PF01016; HMM-score: 117.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021947
    • TAT(Tat/SPI): 0.003805
    • LIPO(Sec/SPII): 0.0037
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGRGGDDTLFAKIDGVVKFERKGRDKKQVSVYAVAE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=NWMN_RS08675&oldid=83853"