Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2033 [new locus tag: SA_RS11690 ]
- pan locus tag?: SAUPAN005687000
- symbol: rplF
- pan gene symbol?: rplF
- synonym:
- product: 50S ribosomal protein L6
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2033 [new locus tag: SA_RS11690 ]
- symbol: rplF
- product: 50S ribosomal protein L6
- replicon: chromosome
- strand: -
- coordinates: 2301007..2301543
- length: 537
- essential: yes [1] DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124953 NCBI
- RefSeq: NP_375348 NCBI
- BioCyc: see SA_RS11690
- MicrobesOnline: 104374 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAGTCGTGTTGGTAAGAAAATTATTGACATCCCTAGTGACGTAACAGTAACTTTTGAT
GGAAATCATGTAACTGTTAAAGGTCCTAAAGGTGAATTATCAAGAACTTTAAATGAAAGA
ATGACATTCAAACAAGAAGAAAACACAATTGAAGTTGTAAGACCATCTGATTCTAAAGAA
GATAGAACAAACCATGGTACAACTCGTGCTTTATTAAACAATATGGTACAAGGTGTTTCT
CAAGGATACGTAAAAGTACTTGAACTTGTTGGTGTAGGTTACCGTGCTCAAATGCAAGGT
AAAGACTTAATCCTTAACGTTGGTTATTCTCACCCAGTAGAAATTAAAGCTGAAGAAAAC
ATTACTTTCTCAGTTGAGAAAAACACAGTCGTTAAAGTTGAAGGTATTTCAAAAGAACAA
GTTGGAGCATTAGCATCTAACATCCGTTCAGTAAGACCTCCAGAGCCTTACAAAGGTAAA
GGTATTCGTTACCAAGGTGAATACGTTCGCCGTAAAGAAGGTAAAACTGGTAAATAA60
120
180
240
300
360
420
480
537
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2033 [new locus tag: SA_RS11690 ]
- symbol: RplF
- description: 50S ribosomal protein L6
- length: 178
- theoretical pI: 10.1171
- theoretical MW: 19786.4
- GRAVY: -0.635955
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRVGKKIIDIPSDVTVTFDGNHVTVKGPKGELSRTLNERMTFKQEENTIEVVRPSDSKEDRTNHGTTRALLNNMVQGVSQGYVKVLELVGVGYRAQMQGKDLILNVGYSHPVEIKAEENITFSVEKNTVVKVEGISKEQVGALASNIRSVRPPEPYKGKGIRYQGEYVRRKEGKTGK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- ⊟interaction partners:
SA1984 (asp23) alkaline shock protein 23 [2] (data from MRSA252) SA1309 (cmk) cytidylate kinase [2] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [2] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [2] (data from MRSA252) SA1074 (fabG) 3-oxoacyl-ACP reductase [2] (data from MRSA252) SA0505 (fus) elongation factor G [2] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [2] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [2] (data from MRSA252) SA1150 (glnA) glutamine-ammonia ligase [2] (data from MRSA252) SA1342 (gnd) 6-phosphogluconate dehydrogenase [2] (data from MRSA252) SA0375 (guaB) inositol-monophosphate dehydrogenase [2] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [2] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [2] (data from MRSA252) SA0823 (pgi) glucose-6-phosphate isomerase [2] (data from MRSA252) SA0934 (ptsH) phosphocarrier protein HPr [2] (data from MRSA252) SA2044 (rplB) 50S ribosomal protein L2 [2] (data from MRSA252) SA2035 (rplE) 50S ribosomal protein L5 [2] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [2] (data from MRSA252) SA0495 (rplK) 50S ribosomal protein L11 [2] (data from MRSA252) SA2022 (rplQ) 50S ribosomal protein L17 [2] (data from MRSA252) SA2045 (rplW) 50S ribosomal protein L23 [2] (data from MRSA252) SA0459 (rplY) 50S ribosomal protein L25 [2] (data from MRSA252) SA1922 (rpmE2) 50S ribosomal protein L31 [2] (data from MRSA252) SA1308 (rpsA) 30S ribosomal protein S1 [2] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [2] (data from MRSA252) SA0503 (rpsL) 30S ribosomal protein S12 [2] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [2] (data from MRSA252) SA0437 hypothetical protein [2] (data from MRSA252) SA0468 hypothetical protein [2] (data from MRSA252) SA0618 hypothetical protein [2] (data from MRSA252) SA0627 hypothetical protein [2] (data from MRSA252) SA0641 hypothetical protein [2] (data from MRSA252) SA0707 hypothetical protein [2] (data from MRSA252) SA0873 hypothetical protein [2] (data from MRSA252) SA1271 threonine dehydratase [2] (data from MRSA252) SA1443 hypothetical protein [2] (data from MRSA252) SA1565 hypothetical protein [2] (data from MRSA252) SA1572 dipeptidase PepV [2] (data from MRSA252) SA1671 hypothetical protein [2] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
Mol Microbiol: 2002, 43(6);1387-400
[PubMed:11952893] [WorldCat.org] [DOI] (P p) - ↑ Jump up to: 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)