Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1467 [new locus tag: SA_RS08265 ]
- pan locus tag?: SAUPAN004247000
- symbol: ruvB
- pan gene symbol?: ruvB
- synonym:
- product: Holliday junction DNA helicase RuvB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1467 [new locus tag: SA_RS08265 ]
- symbol: ruvB
- product: Holliday junction DNA helicase RuvB
- replicon: chromosome
- strand: -
- coordinates: 1676292..1677296
- length: 1005
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124311 NCBI
- RefSeq: NP_374754 NCBI
- BioCyc: see SA_RS08265
- MicrobesOnline: 103780 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961ATGAATGAGCGTATGGTTGATCAATCAATGCATAGTGAAGAAACTGATTTCGAATTGTCG
CTTAGACCTACGAGATTACGACAATATATTGGTCAAAATTCAATAAAAAGTAATTTAGAA
GTATTTATTAAAGCGGCTAAACTTCGTCATGAACCATTAGATCATGTATTGCTTTTTGGC
CCCCCTGGATTAGGTAAGACAACATTATCTAATATCATTGCCAATGAAATGGAAGTTAAT
ATACGTACAGTATCAGGGCCTTCATTAGAAAGACCTGGTGATTTGGCTGCAATTTTATCA
GGACTTCAACCTGGAGATGTATTGTTTATTGATGAAATACACAGACTGAGTAGTGTTGTT
GAAGAAGTGTTATACCCTGCAATGGAAGATTTCTTTTTAGATATTATCATTGGTAAAGGC
GATGAGGCTAGAAGTATCCGTATCGACTTACCTCCATTCACTTTGGTAGGTGCAACAACG
CGAGCTGGCAGCTTAACAGGTCCACTAAGGGATCGATTTGGTGTGCACTTAAGATTAGAA
TATTATAATGAATCAGATTTAAAAGAAATCATTATTAGAACAGCTGAGGTTTTAGGCACA
GGTATTGATGAAGAAAGTGCCATTGAACTTGCTAAACGTTCTAGAGGGACTCCAAGAGTA
GCAAATCGACTATTGAAGCGGGTAAGAGACTTCCAGCAAGTGAATGAAGATGAACAAATA
TACATTGAAACAACGAAGCACGCATTAGGTTTACTTCAAGTTGATCAACACGGACTAGAT
TACATTGATCATAAAATGATGAACTGTATTATTAAGCAGTATAATGGTGGACCTGTTGGT
TTAGATACGATTGCCGTAACAATTGGTGAAGAACGTATTACAATTGAGGACGTTTATGAG
CCATTTCTTATTCAGAAAGGCTTTTTAGAACGTACGCCACGTGGCAGAAAAGCAACACCA
TTAGCTTATGAACATTTTGCAAAGTCGAATGAGGAGAGAGGATAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
1005
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1467 [new locus tag: SA_RS08265 ]
- symbol: RuvB
- description: Holliday junction DNA helicase RuvB
- length: 334
- theoretical pI: 5.18816
- theoretical MW: 37645.7
- GRAVY: -0.313772
⊟Function[edit | edit source]
- reaction: EC 3.1.22.4? ExPASyCrossover junction endodeoxyribonuclease Endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (Holliday junction)EC 3.6.4.12? ExPASyDNA helicase ATP + H2O = ADP + phosphate
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 467)and 26 moreDNA metabolism DNA replication, recombination, and repair DNA polymerase III, subunit gamma and tau (TIGR02397; EC 2.7.7.7; HMM-score: 32.4)Cellular processes Sporulation and germination ATP-dependent protease, Lon family (TIGR02903; EC 3.4.21.-; HMM-score: 31.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent protease, Lon family (TIGR02903; EC 3.4.21.-; HMM-score: 31.2)Cellular processes Sporulation and germination ATP-dependent protease LonB (TIGR02902; EC 3.4.21.-; HMM-score: 29.3)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent protease LonB (TIGR02902; EC 3.4.21.-; HMM-score: 29.3)AAA family ATPase, CDC48 subfamily (TIGR01243; HMM-score: 26.7)26S proteasome subunit P45 family (TIGR01242; HMM-score: 20.6)DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 19)Protein fate Protein and peptide secretion and trafficking type VII secretion AAA-ATPase EccA (TIGR03922; HMM-score: 18.7)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 18.4)DNA metabolism DNA replication, recombination, and repair chromosomal replication initiator protein DnaA (TIGR00362; HMM-score: 17.8)Cellular processes Cell division ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 17.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent metallopeptidase HflB (TIGR01241; EC 3.4.24.-; HMM-score: 17.2)Protein fate Degradation of proteins, peptides, and glycopeptides putative ATP-dependent protease (TIGR00764; HMM-score: 16.2)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions adenylate kinase (TIGR01351; EC 2.7.4.-; HMM-score: 15.4)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 14.7)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 14)Protein fate Degradation of proteins, peptides, and glycopeptides endopeptidase La (TIGR00763; EC 3.4.21.53; HMM-score: 13.4)Protein fate Degradation of proteins, peptides, and glycopeptides proteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 13.2)Cellular processes Sporulation and germination stage V sporulation protein K (TIGR02881; HMM-score: 13.1)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12)Cellular processes Other gas vesicle protein GvpN (TIGR02640; HMM-score: 11.5)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.2)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.1)Protein fate Protein folding and stabilization ATP-dependent Clp protease, ATP-binding subunit ClpX (TIGR00382; HMM-score: 11.1)Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium chelatase ATPase subunit I (TIGR02030; EC 6.6.1.1; HMM-score: 11.1)
- TheSEED :
- Holliday junction ATP-dependent DNA helicase RuvB (EC 3.6.4.12)
and 1 more - PFAM: P-loop_NTPase (CL0023) RuvB_N; Holliday junction DNA helicase RuvB P-loop domain (PF05496; HMM-score: 263.7)and 29 moreAAA_lid (CL0671) AAA_lid_4; RuvB AAA lid domain (PF17864; HMM-score: 103.8)HTH (CL0123) RuvB_C; RuvB C-terminal winged helix domain (PF05491; HMM-score: 85.5)P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 74.2)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 32.5)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 22.3)AAA_22; AAA domain (PF13401; HMM-score: 20.9)AAA_14; AAA domain (PF13173; HMM-score: 20)DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 19.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.5)RNA_helicase; RNA helicase (PF00910; HMM-score: 19)AAA_3; ATPase family associated with various cellular activities (AAA) (PF07726; HMM-score: 18.8)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 18.3)bpMoxR; MoxR domain in the MoxR-vWA-beta-propeller ternary systems (PF20030; HMM-score: 17)ABC_tran; ABC transporter (PF00005; HMM-score: 16.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.9)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 15.8)AAA_18; AAA domain (PF13238; HMM-score: 15.8)Sigma54_activ_2; Sigma-54 interaction domain (PF14532; HMM-score: 15.8)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 15.1)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 15)AAA_28; AAA domain (PF13521; HMM-score: 15)NTPase_1; NTPase (PF03266; HMM-score: 14.8)TIP49; TIP49 P-loop domain (PF06068; HMM-score: 14.5)AAA_2; AAA domain (Cdc48 subfamily) (PF07724; HMM-score: 14)AAA_17; AAA domain (PF13207; HMM-score: 13.6)Bac_DnaA; Bacterial DnaA ATPAse domain (PF00308; HMM-score: 13.2)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 13.1)NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.1)AAA_24; AAA domain (PF13479; HMM-score: 11.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9928
- Cytoplasmic Membrane Score: 0.0051
- Cell wall & surface Score: 0
- Extracellular Score: 0.0021
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003423
- TAT(Tat/SPI): 0.000889
- LIPO(Sec/SPII): 0.000392
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNERMVDQSMHSEETDFELSLRPTRLRQYIGQNSIKSNLEVFIKAAKLRHEPLDHVLLFGPPGLGKTTLSNIIANEMEVNIRTVSGPSLERPGDLAAILSGLQPGDVLFIDEIHRLSSVVEEVLYPAMEDFFLDIIIGKGDEARSIRIDLPPFTLVGATTRAGSLTGPLRDRFGVHLRLEYYNESDLKEIIIRTAEVLGTGIDEESAIELAKRSRGTPRVANRLLKRVRDFQQVNEDEQIYIETTKHALGLLQVDQHGLDYIDHKMMNCIIKQYNGGPVGLDTIAVTIGEERITIEDVYEPFLIQKGFLERTPRGRKATPLAYEHFAKSNEERG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA2428 (arcA) arginine deiminase [1] (data from MRSA252) SA1984 (asp23) alkaline shock protein 23 [1] (data from MRSA252) SA1517 (citC) isocitrate dehydrogenase [1] (data from MRSA252) SA1409 (dnaK) molecular chaperone DnaK [1] (data from MRSA252) SA0731 (eno) phosphopyruvate hydratase [1] (data from MRSA252) SA0915 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [1] (data from MRSA252) SA1029 (ftsZ) cell division protein FtsZ [1] (data from MRSA252) SA0505 (fus) elongation factor G [1] (data from MRSA252) SA0727 (gap) glyceraldehyde-3-phosphate dehydrogenase [1] (data from MRSA252) SA1510 (gapB) glyceraldehyde 3-phosphate dehydrogenase 2 [1] (data from MRSA252) SA1716 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [1] (data from MRSA252) SA1715 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [1] (data from MRSA252) SA1959 (glmS) glucosamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA1141 (glpK) glycerol kinase [1] (data from MRSA252) SA0819 (gudB) NAD-specific glutamate dehydrogenase [1] (data from MRSA252) SA2400 (mqo2) malate:quinone oxidoreductase [1] (data from MRSA252) SA1926 (murZ) UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA2334 (mvaS) 3-hydroxy-3-methylglutaryl-CoA synthase [1] (data from MRSA252) SA0686 (nrdE) ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA0944 (pdhB) pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA0945 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 subunit [1] (data from MRSA252) SA0946 (pdhD) dihydrolipoamide dehydrogenase [1] (data from MRSA252) SA1938 (pdp) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA0218 (pflB) formate acetyltransferase [1] (data from MRSA252) SA1520 (pykA) pyruvate kinase [1] (data from MRSA252) SA2046 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SA0497 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SA1502 (rplT) 50S ribosomal protein L20 [1] (data from MRSA252) SA2042 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SA2036 (rplX) 50S ribosomal protein L24 [1] (data from MRSA252) SA1099 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) SA2041 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SAS052 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SA2031 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SA2016 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SA2048 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SA0708 (secA) preprotein translocase subunit SecA [1] (data from MRSA252) SA1245 (sucA) 2-oxoglutarate dehydrogenase E1 [1] (data from MRSA252) SA1089 (sucD) succinyl-CoA synthetase subunit alpha [1] (data from MRSA252) SA1506 (thrS) threonyl-tRNA synthetase [1] (data from MRSA252) SA0506 (tuf) elongation factor Tu [1] (data from MRSA252) SA1914 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) SA0627 hypothetical protein [1] (data from MRSA252) SA0802 hypothetical protein [1] (data from MRSA252) SA0829 hypothetical protein [1] (data from MRSA252) SA1271 threonine dehydratase [1] (data from MRSA252) SA1532 hypothetical protein [1] (data from MRSA252) SA2327 pyruvate oxidase [1] (data from MRSA252) SA2395 L-lactate dehydrogenase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)