⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0017 [new locus tag: NWMN_RS00100 ]
- pan locus tag?: SAUPAN000032000
- symbol: vicR
- pan gene symbol?: walR
- synonym:
- product: response regulator protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0017 [new locus tag: NWMN_RS00100 ]
- symbol: vicR
- product: response regulator protein
- replicon: chromosome
- strand: +
- coordinates: 24926..25633
- length: 708
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331648 NCBI
- RefSeq: YP_001331052 NCBI
- BioCyc:
- MicrobesOnline: 3705548 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361
 421
 481
 541
 601
 661ATGCAAATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTA
 GAATTTAACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCA
 GTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTACTAGATATCATGTTACCTGGT
 CGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATAATAATG
 CTTACTGCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGAC
 TATGTAACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGT
 CGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAA
 GATATTGTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTA
 ACACATCGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACA
 CGTGAACATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTC
 GATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACATCCTGAATAT
 ATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG60
 120
 180
 240
 300
 360
 420
 480
 540
 600
 660
 708
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0017 [new locus tag: NWMN_RS00100 ]
- symbol: VicR
- description: response regulator protein
- length: 235
- theoretical pI: 4.81211
- theoretical MW: 27451.1
- GRAVY: -0.478298
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 191.8)and 7 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 132.5)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.5)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.5)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.5)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 69.4)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 41.3)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 40.2)
- TheSEED  : - Two-component response regulator SA14-24
 
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 107.1)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 102.8)and 1 moreCheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 15.8)
⊟Structure, modifications & cofactors[edit | edit source]
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.9924
- Cytoplasmic Membrane Score: 0.0058
- Cell wall & surface Score: 0
- Extracellular Score: 0.0018
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.003541
- TAT(Tat/SPI): 0.000213
- LIPO(Sec/SPII): 0.000478
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners: NWMN_0961 (pdhC) branched-chain alpha-keto acid dehydrogenase subunit E2 [1] (data from MRSA252) NWMN_1385 (rpsA) 30S ribosomal protein S1 [1] (data from MRSA252) NWMN_1166 (rpsB) 30S ribosomal protein S2 [1] (data from MRSA252) NWMN_2146 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) NWMN_2016 (upp) uracil phosphoribosyltransferase [1] (data from MRSA252) NWMN_0428 ABC transporter substrate-binding protein [1] (data from MRSA252) NWMN_0475 cysteine synthase-like protein [1] (data from MRSA252) NWMN_2504 malate:quinone oxidoreductase [1] (data from MRSA252) 
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: vicR > vicK > NWMN_0019 > NWMN_0020
⊟Regulation[edit | edit source]
- regulator: Rex* (repression) regulonRex* (TF) important in Energy metabolism; RegPrecise 
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner  
 Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
 J Proteome Res: 2011, 10(3);1139-50
 [PubMed:21166474] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Sarah Dubrac, Tarek Msadek  
Identification of genes controlled by the essential YycG/YycF two-component system of Staphylococcus aureus. 
J Bacteriol: 2004, 186(4);1175-81 
[PubMed:14762013]  [WorldCat.org] [DOI] (P p)Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek  
New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus. 
J Bacteriol: 2007, 189(22);8257-69 
[PubMed:17827301]  [WorldCat.org] [DOI] (I p)Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek  
The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response. 
Infect Immun: 2012, 80(10);3438-53 
[PubMed:22825451]  [WorldCat.org] [DOI] (I p)