From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000020
  • pan locus tag?: SAUPAN000032000
  • symbol: yycF
  • pan gene symbol?: walR
  • synonym:
  • product: response regulator YycF

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000020
  • symbol: yycF
  • product: response regulator YycF
  • replicon: chromosome
  • strand: +
  • coordinates: 24403..25104
  • length: 702
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTT
    AACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGAC
    TTAATTTATGAAGAAGAACCAGACATCGTATTATTAGATATCATGTTACCTGGTCGTGAT
    GGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATTATAATGCTTACT
    GCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTA
    ACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCAT
    TACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATT
    GTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACAT
    CGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAA
    CATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTA
    ACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACACCCTGAATATATTGTG
    ACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    702

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000020
  • symbol: YycF
  • description: response regulator YycF
  • length: 233
  • theoretical pI: 4.81211
  • theoretical MW: 27191.8
  • GRAVY: -0.475536

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 191.9)
    and 7 more
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 132.5)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 69.4)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 41.1)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 40.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 107.1)
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 102.8)
    and 1 more
    CheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 15.1)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9911
    • Cytoplasmic Membrane Score: 0.007
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0019
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004145
    • TAT(Tat/SPI): 0.000213
    • LIPO(Sec/SPII): 0.000302
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: Rex* (repression) regulon
    Rex*(TF)important in Energy metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [4]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
    New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
    J Bacteriol: 2007, 189(22);8257-69
    [PubMed:17827301] [WorldCat.org] [DOI] (I p)
  2. Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek
    The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response.
    Infect Immun: 2012, 80(10);3438-53
    [PubMed:22825451] [WorldCat.org] [DOI] (I p)
  3. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  4. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Sarah Dubrac, Tarek Msadek
Identification of genes controlled by the essential YycG/YycF two-component system of Staphylococcus aureus.
J Bacteriol: 2004, 186(4);1175-81
[PubMed:14762013] [WorldCat.org] [DOI] (P p)
Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
J Bacteriol: 2007, 189(22);8257-69
[PubMed:17827301] [WorldCat.org] [DOI] (I p)
Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek
The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response.
Infect Immun: 2012, 80(10);3438-53
[PubMed:22825451] [WorldCat.org] [DOI] (I p)