⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000020
- pan locus tag?: SAUPAN000032000
- symbol: yycF
- pan gene symbol?: walR
- synonym:
- product: response regulator YycF
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000020
- symbol: yycF
- product: response regulator YycF
- replicon: chromosome
- strand: +
- coordinates: 24403..25104
- length: 702
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTT
AACTTAAAAAAAGAAGGATACGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGAC
TTAATTTATGAAGAAGAACCAGACATCGTATTATTAGATATCATGTTACCTGGTCGTGAT
GGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATTATAATGCTTACT
GCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTA
ACGAAACCGTTTAGTACGCGTGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCAT
TACTCACAACCAGCACAAGACACTGGAAATGTAACGAATGAAATCACAATTAAAGATATT
GTGATTTATCCAGACGCATATTCTATTAAAAAACGTGGCGAAGATATTGAATTAACACAT
CGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAA
CATTTATTACAAACAGTATGGGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTA
ACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGTCACACCCTGAATATATTGTG
ACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG60
120
180
240
300
360
420
480
540
600
660
702
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000020
- symbol: YycF
- description: response regulator YycF
- length: 233
- theoretical pI: 4.81211
- theoretical MW: 27191.8
- GRAVY: -0.475536
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 235.8)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 191.9)and 7 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 132.5)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 70.6)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 69.4)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 41.1)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 40.3)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 107.1)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 102.8)and 1 moreCheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 15.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: WalK (sensor histidine kinase)
- genes regulated by WalR*, response regulator important in cell wall homeostasis
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9911
- Cytoplasmic Membrane Score: 0.007
- Cell wall & surface Score: 0
- Extracellular Score: 0.0019
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004145
- TAT(Tat/SPI): 0.000213
- LIPO(Sec/SPII): 0.000302
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : yycF > walK > yycH > JSNZ_000023
⊟Regulation[edit | edit source]
- regulator: Rex* (repression) regulon
Rex* (TF) important in Energy metabolism; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Sarah Dubrac, Tarek Msadek
Identification of genes controlled by the essential YycG/YycF two-component system of Staphylococcus aureus.
J Bacteriol: 2004, 186(4);1175-81
[PubMed:14762013] [WorldCat.org] [DOI] (P p)Sarah Dubrac, Ivo Gomperts Boneca, Olivier Poupel, Tarek Msadek
New insights into the WalK/WalR (YycG/YycF) essential signal transduction pathway reveal a major role in controlling cell wall metabolism and biofilm formation in Staphylococcus aureus.
J Bacteriol: 2007, 189(22);8257-69
[PubMed:17827301] [WorldCat.org] [DOI] (I p)Aurélia Delauné, Sarah Dubrac, Charlène Blanchet, Olivier Poupel, Ulrike Mäder, Aurélia Hiron, Aurélie Leduc, Catherine Fitting, Pierre Nicolas, Jean-Marc Cavaillon, Minou Adib-Conquy, Tarek Msadek
The WalKR system controls major staphylococcal virulence genes and is involved in triggering the host inflammatory response.
Infect Immun: 2012, 80(10);3438-53
[PubMed:22825451] [WorldCat.org] [DOI] (I p)