From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1888 [new locus tag: SAUSA300_RS10330 ]
  • pan locus tag?: SAUPAN004936000
  • symbol: SAUSA300_1888
  • pan gene symbol?: hisR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1888 [new locus tag: SAUSA300_RS10330 ]
  • symbol: SAUSA300_1888
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2052515..2052817
  • length: 303
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
    TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
    CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
    ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAGCGTTCATTA
    CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
    TAA
    60
    120
    180
    240
    300
    303

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1888 [new locus tag: SAUSA300_RS10330 ]
  • symbol: SAUSA300_1888
  • description: hypothetical protein
  • length: 100
  • theoretical pI: 4.27043
  • theoretical MW: 11518.9
  • GRAVY: -0.402

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)
    and 2 more
    Metabolism Amino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)
    Signal transduction Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
  • TheSEED  :
    • His repressor
    CBSS-393121.3.peg.1913  His repressor
  • PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 122.9)
    and 5 more
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 21.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.4)
    RGS (CL0272) RGS; Regulator of G protein signaling domain (PF00615; HMM-score: 15)
    no clan defined DUF5338; Family of unknown function (DUF5338) (PF17273; HMM-score: 13.2)
    HTH (CL0123) HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9508
    • Cytoplasmic Membrane Score: 0.0332
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0157
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003872
    • TAT(Tat/SPI): 0.000703
    • LIPO(Sec/SPII): 0.000578
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: HisR* (repression) regulon
    HisR*(TF)important in Histidine biosynthesis; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Semen A Leyn, Marat D Kazanov, Natalia V Sernova, Ekaterina O Ermakova, Pavel S Novichkov, Dmitry A Rodionov
Genomic reconstruction of the transcriptional regulatory network in Bacillus subtilis.
J Bacteriol: 2013, 195(11);2463-73
[PubMed:23504016] [WorldCat.org] [DOI] (I p)