Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10330 [old locus tag: SAUSA300_1888 ]
- pan locus tag?: SAUPAN004936000
- symbol: SAUSA300_RS10330
- pan gene symbol?: hisR
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10330 [old locus tag: SAUSA300_1888 ]
- symbol: SAUSA300_RS10330
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2052515..2052817
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2052515..2052817) NCBI
- BioCyc: SAUSA300_RS10330 BioCyc
- MicrobesOnline: see SAUSA300_1888
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAGCGTTCATTA
CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10330 [old locus tag: SAUSA300_1888 ]
- symbol: SAUSA300_RS10330
- description: hypothetical protein
- length: 100
- theoretical pI: 4.27043
- theoretical MW: 11518.9
- GRAVY: -0.402
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)and 2 moreAmino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
- TheSEED: see SAUSA300_1888
- PFAM: HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 117.4)and 4 moreHTH_38; Helix-turn-helix domain (PF13936; HMM-score: 29.5)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.5)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14.5)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by HisR*, TF important in Histidine biosynthesis: see SAUSA300_1888
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003872
- TAT(Tat/SPI): 0.000703
- LIPO(Sec/SPII): 0.000578
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 447088107 NCBI
- RefSeq: WP_001165363 NCBI
- UniProt: see SAUSA300_1888
⊟Protein sequence[edit | edit source]
- MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: HisR* see SAUSA300_1888
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.