Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
- pan locus tag?: SAUPAN004936000
- symbol: SACOL1968
- pan gene symbol?: hisR
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
- symbol: SACOL1968
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2031752..2032054
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238635 NCBI
- RefSeq: YP_186792 NCBI
- BioCyc: see SACOL_RS10290
- MicrobesOnline: 913446 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAGCGTTCATTA
CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
- symbol: SACOL1968
- description: hypothetical protein
- length: 100
- theoretical pI: 4.27043
- theoretical MW: 11518.9
- GRAVY: -0.402
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)and 2 moreAmino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
- TheSEED :
- His repressor
- PFAM: HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 122.9)and 5 moreHTH_38; Helix-turn-helix domain (PF13936; HMM-score: 21.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.4)RGS (CL0272) RGS; Regulator of G protein signaling domain (PF00615; HMM-score: 15)no clan defined DUF5338; Family of unknown function (DUF5338) (PF17273; HMM-score: 13.2)HTH (CL0123) HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Histidine
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9508
- Cytoplasmic Membrane Score: 0.0332
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0157
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003872
- TAT(Tat/SPI): 0.000703
- LIPO(Sec/SPII): 0.000578
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 275 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: HisR* (repression) regulon
HisR* (TF) important in Histidine biosynthesis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Semen A Leyn, Marat D Kazanov, Natalia V Sernova, Ekaterina O Ermakova, Pavel S Novichkov, Dmitry A Rodionov
Genomic reconstruction of the transcriptional regulatory network in Bacillus subtilis.
J Bacteriol: 2013, 195(11);2463-73
[PubMed:23504016] [WorldCat.org] [DOI] (I p)