Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0947 [new locus tag: SACOL_RS04855 ]
- pan locus tag?: SAUPAN003044000
- symbol: SACOL0947
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0947 [new locus tag: SACOL_RS04855 ]
- symbol: SACOL0947
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 949971..950345
- length: 375
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237723 NCBI
- RefSeq: YP_185816 NCBI
- BioCyc: see SACOL_RS04855
- MicrobesOnline: 912417 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACTCATTTATTAGAGACATTTGAGATGTCAATAGATCACCAGGAAGATGGTTTAGTT
GTTATTTCTATGCCTGTTACTGATAAAGTAAAACAACCATTTGGATATTTACATGGTGGG
GCTTCGATTGCTTTAGGTGAAACAGCATGTTCATTAGGATCTGCTAATTTAATTGATACA
ACCAAATTTATTCCATTAGGTTTAGAGATGAATGCTAACCATATTCATTCTGCTAAAGAT
GGTCGTGTTACTGCGACAGCTGAAATTATTCATCGAGGTAAGTCGACACATGTATGGGAT
ATAAAAATTAAGAATGACAAAGAACAATTAATTACAGTTATGCGTGGTACAGTTGCTATT
AAACCTTTAAAATAA60
120
180
240
300
360
375
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0947 [new locus tag: SACOL_RS04855 ]
- symbol: SACOL0947
- description: hypothetical protein
- length: 124
- theoretical pI: 7.23489
- theoretical MW: 13544.6
- GRAVY: -0.0669355
⊟Function[edit | edit source]
- TIGRFAM: uncharacterized domain 1 (TIGR00369; HMM-score: 99.9)and 1 morephenylacetic acid degradation protein PaaD (TIGR02286; HMM-score: 38.9)
- TheSEED :
- 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (EC 3.1.2.28) in menaquinone biosynthesis
- PFAM: HotDog (CL0050) 4HBT; Thioesterase superfamily (PF03061; HMM-score: 58.3)and 3 more4HBT_3; Acyl-CoA thioesterase N-terminal domain (PF13622; HMM-score: 21.1)DUF4442; Domain of unknown function (DUF4442) (PF14539; HMM-score: 21)GlnB-like (CL0089) CutA1; CutA1 divalent ion tolerance protein (PF03091; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9914
- Cytoplasmic Membrane Score: 0.0002
- Cell wall & surface Score: 0
- Extracellular Score: 0.0083
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007452
- TAT(Tat/SPI): 0.002648
- LIPO(Sec/SPII): 0.000704
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTHLLETFEMSIDHQEDGLVVISMPVTDKVKQPFGYLHGGASIALGETACSLGSANLIDTTKFIPLGLEMNANHIHSAKDGRVTATAEIIHRGKSTHVWDIKIKNDKEQLITVMRGTVAIKPLK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: HisR* (repression) regulon
HisR* (TF) important in Histidine biosynthesis; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)