Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02675
- pan locus tag?: SAUPAN005922000
- symbol: SAOUHSC_02675
- pan gene symbol?: nreC
- synonym: JSNZ_002359
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02675
- symbol: SAOUHSC_02675
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2458898..2459500
- length: 603
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921237 NCBI
- RefSeq: YP_501137 NCBI
- BioCyc: G1I0R-2521 BioCyc
- MicrobesOnline: 1291108 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGATTTTAAATTATCAAAATGATATGGAAGTTGTTGCAACGGCTGCAGATGGCGTCGAA
GCTTACCAAAAAGTAATGGAATATAAACCTGATGTGTTACTAATGGATTTAAGTATGCCA
CCAGGTGAGTCAGGTCTTATCGCTACGAGTAAAATTGCTGACAGTTTTCCTGAAACTAAA
ATACTAATATTAACAATGTTTGATGATGAGGAGTATTTGTTCCATGTGTTGCGTAATGGT
GCGAAAGGTTACATATTGAAAAATGCACCTGATGAACAATTATTGTTAGCTATTCGAACT
GTATATAAAGGTGAAACATATGTAGATATGAAACTTACAACATCTTTAGTGAATGAATTT
GTATCTAATTCAAATCAGGACACTGCAAACACAACAGATCCTTTTAAAATCTTATCAAAA
CGAGAACTAGAAATATTGCCACTTATTGCCAAAGGTTACGGGAATAAAGAAATTGCAGAG
AAATTATTTGTATCTGTGAAAACAGTAGAAGCACATAAGACGCATATTATGACAAAGCTT
GGCTTAAAGAGTAAACCTGAGCTAGTTGAATATGCATTGAAAAAGAAATTATTAGAGTTT
TAG60
120
180
240
300
360
420
480
540
600
603
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02675
- symbol: SAOUHSC_02675
- description: hypothetical protein
- length: 200
- theoretical pI: 5.141
- theoretical MW: 22527
- GRAVY: -0.1315
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 49.3)and 14 moreLuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 39.2)transcriptional regulator EpsA (TIGR03020; HMM-score: 37.7)Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 31)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 31)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 30.6)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24.8)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 21.7)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.1)proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 14.7)RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 11.9)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 11.4)
- TheSEED :
- response regulator
- PFAM: HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 77.2)CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 69.8)and 6 moreHTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.3)Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 14)Pilus (CL0327) Pilin_PilX; Minor type IV pilin, PilX (PF11530; HMM-score: 13.2)HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 13)NADP_Rossmann (CL0063) 3HCDH_RFF; 3-hydroxybutyryl-CoA dehydrogenase reduced Rossmann-fold domain (PF18321; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: NreB (sensor histidine kinase) sensing nitrate and nitrite
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9769
- Cytoplasmic Membrane Score: 0.0078
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0149
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005121
- TAT(Tat/SPI): 0.000178
- LIPO(Sec/SPII): 0.000632
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02675 < SAOUHSC_02676 < SAOUHSC_02677 < SAOUHSC_02678 < SAOUHSC_02679 < SAOUHSC_02680 < SAOUHSC_02681predicted SigA promoter [3] : SAOUHSC_02675 < S1044 < SAOUHSC_02676 < SAOUHSC_02677 < SAOUHSC_02678 < SAOUHSC_02679 < SAOUHSC_02680 < S1045 < SAOUHSC_02681 < S1046
⊟Regulation[edit | edit source]
- regulators: Rex*/JSNZ_002000 (repression) regulon, NreC*/JSNZ_002359 (activation) regulon
Rex*/JSNZ_002000 (TF) important in Energy metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise NreC*/JSNZ_002359 (TF) important in Nitrate and nitrite respiration; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
