From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02675
  • pan locus tag?: SAUPAN005922000
  • symbol: SAOUHSC_02675
  • pan gene symbol?: nreC
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02675
  • symbol: SAOUHSC_02675
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2458898..2459500
  • length: 603
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGATTTTAAATTATCAAAATGATATGGAAGTTGTTGCAACGGCTGCAGATGGCGTCGAA
    GCTTACCAAAAAGTAATGGAATATAAACCTGATGTGTTACTAATGGATTTAAGTATGCCA
    CCAGGTGAGTCAGGTCTTATCGCTACGAGTAAAATTGCTGACAGTTTTCCTGAAACTAAA
    ATACTAATATTAACAATGTTTGATGATGAGGAGTATTTGTTCCATGTGTTGCGTAATGGT
    GCGAAAGGTTACATATTGAAAAATGCACCTGATGAACAATTATTGTTAGCTATTCGAACT
    GTATATAAAGGTGAAACATATGTAGATATGAAACTTACAACATCTTTAGTGAATGAATTT
    GTATCTAATTCAAATCAGGACACTGCAAACACAACAGATCCTTTTAAAATCTTATCAAAA
    CGAGAACTAGAAATATTGCCACTTATTGCCAAAGGTTACGGGAATAAAGAAATTGCAGAG
    AAATTATTTGTATCTGTGAAAACAGTAGAAGCACATAAGACGCATATTATGACAAAGCTT
    GGCTTAAAGAGTAAACCTGAGCTAGTTGAATATGCATTGAAAAAGAAATTATTAGAGTTT
    TAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    603

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_02675
  • symbol: SAOUHSC_02675
  • description: hypothetical protein
  • length: 200
  • theoretical pI: 5.141
  • theoretical MW: 22527
  • GRAVY: -0.1315

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 49.3)
    and 14 more
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 39.2)
    transcriptional regulator EpsA (TIGR03020; HMM-score: 37.7)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 31)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 31)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 30.6)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 27.3)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24.8)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 21.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 19.1)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 14.7)
    RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 11.9)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 11.4)
  • TheSEED  :
    • response regulator
  • PFAM:
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 78.3)
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 71)
    and 6 more
    HTH (CL0123) Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.7)
    DUF2089; Protein of unknown function (DUF2089) (PF09862; HMM-score: 14.5)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 14.1)
    Pilus (CL0327) Pilin_PilX; Minor type IV pilin, PilX (PF11530; HMM-score: 13.2)
    HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005121
    • TAT(Tat/SPI): 0.000178
    • LIPO(Sec/SPII): 0.000632
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: Rex* (repression) regulon, NreC* (activation) regulon
    Rex*(TF)important in Energy metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 
    NreC*(TF)important in Nitrate and nitrite respiration; RegPrecise    transcription unit transferred from N315 data RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_02675&oldid=91472"