From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002359 [new locus tag: EGJ38_RS11775 ]
  • pan locus tag?: SAUPAN005922000
  • symbol: nreC
  • pan gene symbol?: nreC
  • synonym: JSNZ_002359
  • product: nitrate respiration regulation response regulator NreC

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002359 [new locus tag: EGJ38_RS11775 ]
  • symbol: nreC
  • product: nitrate respiration regulation response regulator NreC
  • replicon: chromosome
  • strand: -
  • coordinates: 2357971..2358624
  • length: 654
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2424244 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGAAAATAGTCATTGCCGATGATCACGCTGTTGTCCGTACGGGGTTCTCTATGATTTTA
    AATTATCAAAATGATATGGAAGTTGTTGCAACGGCTGCAGATGGCGTCGAAGCTTACCAA
    AAAGTAATGGAATATAAACCTGATGTGTTACTAATGGATTTAAGTATGCCACCAGGTGAG
    TCAGGTCTTATCGCTACGAGTAAAATTGCTGACAGTTTTCCTGAAACTAAAATACTAATA
    TTAACAATGTTTGATGATGAGGAGTATTTGTTCCATGTGTTGCGTAATGGTGCGAAAGGT
    TACATATTGAAAAATGCACCTGATGAACAATTATTGTTAGCTATTCGAACTGTATATAAA
    GGTGAAACATATGTAGATATGAAACTTACAACATCTTTAGTGAATGAATTTGTATCTAAT
    TCAAATCAGGACACTGCAAACACAACAGATCCTTTTAAAATCTTATCAAAACGAGAACTA
    GAAATATTGCCGCTTATTGCCAAAGGTTACGGGAATAAAGAAATTGCAGAGAAATTATTT
    GTATCTGTGAAAACAGTAGAAGCACATAAGACGCATATTATGACAAAGCTTGGCTTAAAG
    AGTAAACCTGAGCTAGTTGAATATGCATTGAAAAAGAAATTATTAGAGTTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    654

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002359 [new locus tag: EGJ38_RS11775 ]
  • symbol: NreC
  • description: nitrate respiration regulation response regulator NreC
  • length: 217
  • theoretical pI: 5.39357
  • theoretical MW: 24368.2
  • GRAVY: -0.0778802

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 55)
    and 13 more
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 39)
    transcriptional regulator EpsA (TIGR03020; HMM-score: 37.5)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 31.7)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24.5)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 23.5)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 21.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 18.8)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 11.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 86.8)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 76.9)
    and 7 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 18.5)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.1)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 13.8)
    Pilus (CL0327) Pilin_PilX; Minor type IV pilin, PilX (PF11530; HMM-score: 12.9)
    HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 12.9)
    no clan defined DUF3013; Protein of unknown function (DUF3013) (PF11217; HMM-score: 12.5)
    NADP_Rossmann (CL0063) 3HCDH_RFF; 3-hydroxybutyryl-CoA dehydrogenase reduced Rossmann-fold domain (PF18321; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9735
    • Cytoplasmic Membrane Score: 0.0098
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0162
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010951
    • TAT(Tat/SPI): 0.000349
    • LIPO(Sec/SPII): 0.000503
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2424244 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: NreC/JSNZ_002359 (activation) regulon, Rex/JSNZ_002000 (repression) regulon
    NreC/JSNZ_002359(TF)important in Nitrate and nitrite respiration;  regulation predicted or transferred from N315 and NCTC 8325  [2]
    Rex/JSNZ_002000(TF)important in Energy metabolism;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. 2.0 2.1 Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]