Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02679
- pan locus tag?: SAUPAN005926000
- symbol: SAOUHSC_02679
- pan gene symbol?: narJ
- synonym: JSNZ_002363
- product: respiratory nitrate reductase subunit delta
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02679
- symbol: SAOUHSC_02679
- product: respiratory nitrate reductase subunit delta
- replicon: chromosome
- strand: -
- coordinates: 2461774..2462364
- length: 591
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921241 NCBI
- RefSeq: YP_501141 NCBI
- BioCyc: G1I0R-2525 BioCyc
- MicrobesOnline: 1291112 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGAGGGATTTTCCGTGATTAATTTCGATAATTTTAAAAAATATCAAGAAAGTTTTGGA
TATATGGCACAACAGTTATGTTTTCCAGAAAAATTAACTTTTCATCCAAAAACTTTTGAA
GAAACAATTTCGAAAGATCATCCAGCATATGAAGATTTAGTAGCATTTAGAAATGTAATG
ATGACATTTTCATTATCAGAAATCAAAGCGATTTATACAGATACATTTGATTTTACGAAA
AAAGCACCATTATATATGACGTATAACAAATTTGATACGCAAAAAGAACGTGGGCAAATG
TTAGCTAAATTAAAGGTATTATATGAAATGTTTGGACTAGAAATGGTAGATAATGAACTT
TCTGATTATCTACCGTTGATGCTTCAATTTTTGCAAGTGGCAGAATGGCGAAATGATCCA
AGAGCTGAAGAGAATATTCAATTAATCATTATGATTATTGAGGATGGAACATATGTGATG
GCGAATGCACTTGGTGAAGATAACAATCCATATGCCTATGTGATTCAAGCACTTAGAAAA
ACATTGAAATTATGTTTGACATCACCAAAAGGAGTGAAACATCATGCTTAA60
120
180
240
300
360
420
480
540
591
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02679
- symbol: SAOUHSC_02679
- description: respiratory nitrate reductase subunit delta
- length: 196
- theoretical pI: 5.09662
- theoretical MW: 22925.3
- GRAVY: -0.286735
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein folding and stabilization nitrate reductase molybdenum cofactor assembly chaperone (TIGR00684; HMM-score: 65.6)and 1 moreDMSO reductase family type II enzyme chaperone (TIGR03482; HMM-score: 26.6)
- TheSEED :
- Respiratory nitrate reductase molybdenum cofactor assembly chaperone NarJ
- PFAM: no clan defined Nitrate_red_del; Nitrate reductase delta subunit (PF02613; HMM-score: 35.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9873
- Cytoplasmic Membrane Score: 0.0106
- Cell wall & surface Score: 0
- Extracellular Score: 0.0021
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003696
- TAT(Tat/SPI): 0.000164
- LIPO(Sec/SPII): 0.000675
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MEGFSVINFDNFKKYQESFGYMAQQLCFPEKLTFHPKTFEETISKDHPAYEDLVAFRNVMMTFSLSEIKAIYTDTFDFTKKAPLYMTYNKFDTQKERGQMLAKLKVLYEMFGLEMVDNELSDYLPLMLQFLQVAEWRNDPRAEENIQLIIMIIEDGTYVMANALGEDNNPYAYVIQALRKTLKLCLTSPKGVKHHA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02675 < SAOUHSC_02676 < SAOUHSC_02677 < SAOUHSC_02678 < SAOUHSC_02679 < SAOUHSC_02680 < SAOUHSC_02681predicted SigA promoter [3] : SAOUHSC_02675 < S1044 < SAOUHSC_02676 < SAOUHSC_02677 < SAOUHSC_02678 < SAOUHSC_02679 < SAOUHSC_02680 < S1045 < SAOUHSC_02681 < S1046
⊟Regulation[edit | edit source]
- regulators: Rex*/JSNZ_002000 (repression) regulon, NreC*/JSNZ_002359 (activation) regulon
Rex*/JSNZ_002000 (TF) important in Energy metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise NreC*/JSNZ_002359 (TF) important in Nitrate and nitrite respiration; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
