Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02546
- pan locus tag?: SAUPAN005738000
- symbol: SAOUHSC_02546
- pan gene symbol?: modC
- synonym:
- product: molybdenum transport ATP-binding protein ModC
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02546
- symbol: SAOUHSC_02546
- product: molybdenum transport ATP-binding protein ModC
- replicon: chromosome
- strand: -
- coordinates: 2342404..2343009
- length: 606
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921135 NCBI
- RefSeq: YP_501009 NCBI
- BioCyc: G1I0R-2406 BioCyc
- MicrobesOnline: 1290980 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGCTTAAAATCAATGTGAAATATCAATTAAAGAACACTTTAATTCGCATCAATATAGAT
GATACTGAACCAAAAATTTATGCAGTTCGTGGTCCATCTGGCATTGGTAAAACTACTGTT
TTAAATATGATTGCCGGATTACGTAAAGCAGATGAAGCTATTATCGAAGTGAATGGGCAA
TTACTTACTGATACGGCAAAAAACGTGAATGTTAAAATTCAACAACGACGTATTGGATAT
CTGTTTCAAGACTACCAATTGTTTCCTAATATGACGGTCTATAAAAATATTACTTTTATG
GCTGAACCATCTGAACACATCGATCAATTAATTCAAACTTTAAACATTGATCATTTGATG
AAACAATATCCTATGACATTGTCAGGTGGAGAGGCACAACGTGTAGCACTTGCACGTGCA
CTTAGCACGAAACCAGATTTAATTTTATTAGATGAACCTTTTTCTAGTTTGGATGATACT
ACAAAAGATGAGAGTATTACATTAGTTAAACGTATTTTCAACGAATGGCAAATACCAATC
ATATTTGTGACACATTCAAACTATGAAGCAGAACAAATGGCTCATGAAATTATTACAATT
GGGTAA60
120
180
240
300
360
420
480
540
600
606
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02546
- symbol: SAOUHSC_02546
- description: molybdenum transport ATP-binding protein ModC
- length: 201
- theoretical pI: 6.12305
- theoretical MW: 22877.3
- GRAVY: -0.168159
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 195.5)and 74 moreTransport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 151.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 148.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 146.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 146.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 136)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 133.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 129.6)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 128.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 120)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 119.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 114.8)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 114.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 111.9)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 105)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 104.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 103.9)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 103.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 103.7)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 103.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 98.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 98.2)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 96.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 93.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 92.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 89)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 87.1)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 80.7)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 79.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.7)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 77.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 76.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 76.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 74.7)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 74.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 73.7)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 73.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 73.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 73.1)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 73)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 71.6)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 70.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 67.9)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 64.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 60.9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 60.9)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 54.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 54.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 53.7)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 53.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 50)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 50)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 48.6)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 46.4)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 46.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 44.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 43.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 42.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 41.2)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 37.8)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 34)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 33)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 27.1)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 25.7)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 25.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 23.7)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 23.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 23.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.9)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 12.7)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 11.9)
- TheSEED :
- Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.1)and 20 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 23.5)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 23)AAA_22; AAA domain (PF13401; HMM-score: 22.7)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 19.5)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.2)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 18.2)AAA_14; AAA domain (PF13173; HMM-score: 18)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 17.9)TniB; Bacterial TniB protein (PF05621; HMM-score: 17.5)NTPase_1; NTPase (PF03266; HMM-score: 16)no clan defined RseA_C; Anti sigma-E protein RseA, C-terminal domain (PF03873; HMM-score: 16)P-loop_NTPase (CL0023) AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.9)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.3)AAA_19; AAA domain (PF13245; HMM-score: 14.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 14)AAA_30; AAA domain (PF13604; HMM-score: 14)AAA_24; AAA domain (PF13479; HMM-score: 13.3)CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 13.1)P-loop_NTPase (CL0023) NACHT; NACHT domain (PF05729; HMM-score: 12.4)AAA_13; AAA domain (PF13166; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3383
- Cytoplasmic Membrane Score: 0.6546
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0067
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006389
- TAT(Tat/SPI): 0.00023
- LIPO(Sec/SPII): 0.000448
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKINVKYQLKNTLIRINIDDTEPKIYAVRGPSGIGKTTVLNMIAGLRKADEAIIEVNGQLLTDTAKNVNVKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHIDQLIQTLNIDHLMKQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQIPIIFVTHSNYEAEQMAHEIITIG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SAOUHSC_01683 (dnaK) molecular chaperone DnaK [3] (data from MRSA252) SAOUHSC_02116 (gatB) aspartyl/glutamyl-tRNA amidotransferase subunit B [3] (data from MRSA252) SAOUHSC_00519 (rplA) 50S ribosomal protein L1 [3] (data from MRSA252) SAOUHSC_02509 (rplB) 50S ribosomal protein L2 [3] (data from MRSA252) SAOUHSC_02496 (rplF) 50S ribosomal protein L6 [3] (data from MRSA252) SAOUHSC_01211 (rplS) 50S ribosomal protein L19 [3] (data from MRSA252) SAOUHSC_01757 (rplU) 50S ribosomal protein L21 [3] (data from MRSA252) SAOUHSC_01232 (rpsB) 30S ribosomal protein S2 [3] (data from MRSA252) SAOUHSC_02506 (rpsC) 30S ribosomal protein S3 [3] (data from MRSA252) SAOUHSC_02494 (rpsE) 30S ribosomal protein S5 [3] (data from MRSA252) SAOUHSC_01418 (sucA) 2-oxoglutarate dehydrogenase E1 component [3] (data from MRSA252) SAOUHSC_00069 protein A [3] (data from MRSA252) SAOUHSC_00132 aldehyde dehydrogenase [3] (data from MRSA252) SAOUHSC_00529 elongation factor G [3] (data from MRSA252) SAOUHSC_00530 elongation factor Tu [3] (data from MRSA252) SAOUHSC_01040 pyruvate dehydrogenase complex, E1 component subunit alpha [3] (data from MRSA252) SAOUHSC_01041 pyruvate dehydrogenase complex, E1 component subunit beta [3] (data from MRSA252) SAOUHSC_01042 branched-chain alpha-keto acid dehydrogenase subunit E2 [3] (data from MRSA252) SAOUHSC_01043 dihydrolipoamide dehydrogenase [3] (data from MRSA252) SAOUHSC_01150 cell division protein FtsZ [3] (data from MRSA252) SAOUHSC_01416 dihydrolipoamide succinyltransferase [3] (data from MRSA252) SAOUHSC_01801 isocitrate dehydrogenase [3] (data from MRSA252) SAOUHSC_01806 pyruvate kinase [3] (data from MRSA252) SAOUHSC_01819 hypothetical protein [3] (data from MRSA252) SAOUHSC_01820 acetate kinase [3] (data from MRSA252) SAOUHSC_02441 alkaline shock protein 23 [3] (data from MRSA252) SAOUHSC_02849 pyruvate oxidase [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02546 < SAOUHSC_02547 < SAOUHSC_02549predicted SigA promoter [4] : SAOUHSC_02532 < S978 < SAOUHSC_02534 < SAOUHSC_02535 < S979 < SAOUHSC_02536 < mobA < SAOUHSC_02538 < SAOUHSC_02540 < SAOUHSC_02541 < SAOUHSC_02542 < S980 < SAOUHSC_02544 < SAOUHSC_02545 < S981 < SAOUHSC_02546 < SAOUHSC_02547 < SAOUHSC_02549
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [4]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 3.13 3.14 3.15 3.16 3.17 3.18 3.19 3.20 3.21 3.22 3.23 3.24 3.25 3.26 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
