Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02544
- pan locus tag?: SAUPAN005736000
- symbol: SAOUHSC_02544
- pan gene symbol?: moaB
- synonym:
- product: molybdopterin precursor biosynthesis MoaB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02544
- symbol: SAOUHSC_02544
- product: molybdopterin precursor biosynthesis MoaB
- replicon: chromosome
- strand: -
- coordinates: 2340693..2341199
- length: 507
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921133 NCBI
- RefSeq: YP_501007 NCBI
- BioCyc: G1I0R-2404 BioCyc
- MicrobesOnline: 1290978 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGGCGAACATCAAAACGTTAAATTGAATCGTACAGTTAAAGCAGCCGTACTAACGGTA
TCAGATACTAGAGACTTTGATACAGATAAAGGTGGTCAATGCGTGCGCCAACTATTACAA
GCAGATGACGTTGAAGTGAGTGACGCACATTATACAATTGTGAAAGATGAAAAAGTAGCC
ATCACGACGCAGGTGAAGAAGTGGTTAGAAGAAGATATTGATGTCATCATTACGACTGGT
GGAACAGGTATTGCACAACGTGATGTGACGATTGAAGCAGTAAAACCACTTTTAACTAAA
GAGATAGAAGGCTTTGGGGAATTGTTTAGATATTTGAGTTATGTTGAAGATGTTGGCACG
CGTGCATTATTGTCTCGTGCTGTAGCAGGTACAGTTAATAATAAATTGATATTTTCGATT
CCAGGATCAACAGGCGCAGTTAAATTAGCATTAGAAAAGCTCATTAAACCAGAATTAAAT
CATCTGATTCATGAGCTTACAAAATAA60
120
180
240
300
360
420
480
507
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02544
- symbol: SAOUHSC_02544
- description: molybdopterin precursor biosynthesis MoaB
- length: 168
- theoretical pI: 5.68373
- theoretical MW: 18500.1
- GRAVY: -0.119643
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdenum cofactor biosynthesis protein B (TIGR02667; HMM-score: 159.3)and 2 moremolybdenum cofactor synthesis domain (TIGR00177; HMM-score: 122.1)DNA metabolism DNA replication, recombination, and repair competence/damage-inducible protein CinA N-terminal domain (TIGR00200; HMM-score: 11.3)
- TheSEED :
- Molybdenum cofactor biosynthesis protein MoaB
- PFAM: no clan defined MoCF_biosynth; Probable molybdopterin binding domain (PF00994; HMM-score: 104.4)and 1 moreAA_dh_N (CL0603) malic; Malic enzyme, N-terminal domain (PF00390; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9867
- Cytoplasmic Membrane Score: 0.0033
- Cell wall & surface Score: 0.0008
- Extracellular Score: 0.0093
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008014
- TAT(Tat/SPI): 0.000619
- LIPO(Sec/SPII): 0.001577
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGEHQNVKLNRTVKAAVLTVSDTRDFDTDKGGQCVRQLLQADDVEVSDAHYTIVKDEKVAITTQVKKWLEEDIDVIITTGGTGIAQRDVTIEAVKPLLTKEIEGFGELFRYLSYVEDVGTRALLSRAVAGTVNNKLIFSIPGSTGAVKLALEKLIKPELNHLIHELTK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SAOUHSC_02544 < SAOUHSC_02545predicted SigA promoter [3] : SAOUHSC_02532 < S978 < SAOUHSC_02534 < SAOUHSC_02535 < S979 < SAOUHSC_02536 < mobA < SAOUHSC_02538 < SAOUHSC_02540 < SAOUHSC_02541 < SAOUHSC_02542 < S980 < SAOUHSC_02544 < SAOUHSC_02545 < S981 < SAOUHSC_02546 < SAOUHSC_02547 < SAOUHSC_02549
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
