From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02347
  • pan locus tag?: SAUPAN005398000
  • symbol: SAOUHSC_02347
  • pan gene symbol?: atpF
  • synonym:
  • product: F0F1 ATP synthase subunit B

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02347
  • symbol: SAOUHSC_02347
  • product: F0F1 ATP synthase subunit B
  • replicon: chromosome
  • strand: -
  • coordinates: 2172263..2172784
  • length: 522
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGACTGAAACAGCTAACTTATTCGTTCTTGGTGCAGCTGGAGGCGTTGAGTGGGGTACT
    GTGATTGTACAGGTCCTAACTTTCATCGTGTTACTTGCGTTACTTAAAAAGTTCGCATGG
    GGTCCATTGAAAGATGTAATGGATAAACGTGAAAGAGATATTAACAGAGATATCGATGAC
    GCAGAACAAGCTAAGTTAAATGCACAGAAACTTGAAGAAGAAAATAAACAAAAACTTAAA
    GAAACACAAGAAGAAGTTCAAAAGATTTTAGAAGATGCTAAGGTTCAAGCACGTCAACAG
    CAAGAACAAATTATTCATGAAGCAAACGTACGTGCAAACGGTATGATTGAAACAGCACAA
    AGTGAAATCAATAGCCAAAAAGAACGTGCCATTGCAGATATTAATAATCAAGTATCTGAA
    CTATCAGTGTTAATTGCTTCTAAAGTTCTTAGAAAAGAAATTTCTGAACAAGACCAAAAA
    GCATTGGTTGACAAGTATCTAAAAGAGGCAGGCGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    522

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02347
  • symbol: SAOUHSC_02347
  • description: F0F1 ATP synthase subunit B
  • length: 173
  • theoretical pI: 4.75697
  • theoretical MW: 19539.1
  • GRAVY: -0.514451

Function[edit | edit source]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 124.4)
    and 7 more
    alternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 76)
    hydroxylamine oxidation protein HaoB (TIGR04392; HMM-score: 13.5)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 12.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 7.3)
    two transmembrane protein (TIGR04527; HMM-score: 7)
    alternate F1F0 ATPase, F1 subunit alpha (TIGR03324; EC 3.6.3.-; HMM-score: 6.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 4.8)
  • TheSEED  :
    • ATP synthase F0 sector subunit b (EC 7.1.2.2)
    Respiration ATP synthases F0F1-type ATP synthase  ATP synthase F0 sector subunit b
  • PFAM:
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 107.3)
    and 9 more
    Mt_ATP-synt_B; Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405; HMM-score: 22)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 18.2)
    no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 14.3)
    FAM222A; Protein family of FAM222A (PF15258; HMM-score: 13.5)
    RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 10.2)
    Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 8.7)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.4)
    no clan defined YfcL; YfcL protein (PF08891; HMM-score: 8.3)
    UBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 8.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9981
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0019
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005976
    • TAT(Tat/SPI): 0.00052
    • LIPO(Sec/SPII): 0.002479
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]