From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2099 [new locus tag: SACOL_RS10985 ]
  • pan locus tag?: SAUPAN005398000
  • symbol: atpF
  • pan gene symbol?: atpF
  • synonym:
  • product: F0F1 ATP synthase subunit B

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2099 [new locus tag: SACOL_RS10985 ]
  • symbol: atpF
  • product: F0F1 ATP synthase subunit B
  • replicon: chromosome
  • strand: -
  • coordinates: 2161539..2162060
  • length: 522
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGACTGAAACAGCTAACTTATTCGTTCTTGGTGCAGCTGGAGGCGTTGAGTGGGGTACT
    GTGATTGTACAGGTCCTAACTTTCATCGTGTTACTTGCGTTACTTAAAAAGTTCGCATGG
    GGTCCATTGAAAGATGTAATGGATAAACGTGAAAGAGATATTAACAGAGATATCGATGAC
    GCAGAACAAGCTAAGTTAAATGCACAGAAACTTGAAGAAGAAAATAAACAAAAACTTAAA
    GAAACACAAGAAGAAGTTCAAAAGATTTTAGAAGATGCTAAGGTTCAAGCACGTCAACAG
    CAAGAACAAATTATTCATGAAGCAAACGTACGTGCAAACGGTATGATTGAAACAGCACAA
    AGTGAAATCAATAGCCAAAAAGAACGTGCCATTGCAGATATTAATAATCAAGTATCTGAA
    CTATCAGTGTTAATTGCTTCTAAAGTTCTTAGAAAAGAAATTTCTGAACAAGACCAAAAA
    GCATTGGTTGACAAGTATCTAAAAGAGGCAGGCGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    522


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2099 [new locus tag: SACOL_RS10985 ]
  • symbol: AtpF
  • description: F0F1 ATP synthase subunit B
  • length: 173
  • theoretical pI: 4.75697
  • theoretical MW: 19539.1
  • GRAVY: -0.514451

⊟Function[edit | edit source]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPase ATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    Metabolism Energy metabolism ATP-proton motive force interconversion ATP synthase F0, B subunit (TIGR01144; EC 3.6.3.14; HMM-score: 124.4)
    and 7 more
    alternate F1F0 ATPase, F0 subunit B (TIGR03321; EC 3.6.3.-; HMM-score: 76)
    hydroxylamine oxidation protein HaoB (TIGR04392; HMM-score: 13.5)
    ATP synthase archaeal, H subunit (TIGR02926; EC 3.6.3.14; HMM-score: 12.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 7.3)
    two transmembrane protein (TIGR04527; HMM-score: 7)
    alternate F1F0 ATPase, F1 subunit alpha (TIGR03324; EC 3.6.3.-; HMM-score: 6.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds sodium/hydrogen antiporter (TIGR00844; HMM-score: 4.8)
  • TheSEED  :
    • ATP synthase F0 sector subunit b (EC 7.1.2.2)
    Respiration ATP synthases F0F1-type ATP synthase  ATP synthase F0 sector subunit b
  • PFAM:
    ATP_synthase (CL0255) ATP-synt_B; ATP synthase B/B' CF(0) (PF00430; HMM-score: 107.3)
    and 9 more
    Mt_ATP-synt_B; Mitochondrial ATP synthase B chain precursor (ATP-synt_B) (PF05405; HMM-score: 22)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 18.2)
    no clan defined DivIVA; DivIVA protein (PF05103; HMM-score: 14.3)
    FAM222A; Protein family of FAM222A (PF15258; HMM-score: 13.5)
    RapA_C; RNA polymerase recycling family C-terminal (PF12137; HMM-score: 10.2)
    Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 8.7)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.4)
    no clan defined YfcL; YfcL protein (PF08891; HMM-score: 8.3)
    UBA (CL0214) HBS1_N; HBS1 N-terminus (PF08938; HMM-score: 8.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9981
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0019
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005976
    • TAT(Tat/SPI): 0.00052
    • LIPO(Sec/SPII): 0.002479
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTETANLFVLGAAGGVEWGTVIVQVLTFIVLLALLKKFAWGPLKDVMDKRERDINRDIDDAEQAKLNAQKLEEENKQKLKETQEEVQKILEDAKVQARQQQEQIIHEANVRANGMIETAQSEINSQKERAIADINNQVSELSVLIASKVLRKEISEQDQKALVDKYLKEAGDK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Integral membrane [1] [2] [3] [4]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 8.56 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]