Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
- pan locus tag?: SAUPAN004177000
- symbol: SACOL1647
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
- symbol: SACOL1647
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1678878..1679594
- length: 717
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238459 NCBI
- RefSeq: YP_186487 NCBI
- BioCyc: see SACOL_RS08400
- MicrobesOnline: 913096 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCGCAATATGCAGAAATGAGCCTAGTGTACGATCAATTGACTCAAGATCAACCATAT
GAAAAATGGTTTGAAATTGTAAAAAATCACTGCAAAGATGAATCAAATATTTTAGATATT
GGATGCGGTACTGGTAGTTTAACAGTTCAATTAGAAGCTTTAGGTAATGTTACTGGTATG
GATTTAAGTGTTGATATGTTGACTGTTGCAGCTCAAAAATCAGCAAATGTAAATTGGCTT
GAAGGAGATATGACATCTTTTGATTTGCAACAACAATTTGATATCATCACTATTTTTTGT
GACTCTCTAAATTATTTGCAAGATGAAACTGCAGTGATTGAAACATTCATCAATGTTTAT
CATCATCTGACTGATTCAGGTGTATTTATTTTTGATGTACATACTGTTTATAAAATGATG
ACTTTGTTTAATAATCAAAGTTATATTGATGATAAAGGGGACATTTTTTTAGCATGGGAT
GCTGTGCAAGGAGATTTACCTTTAAGTGTTTATCATGATATGACATTTTTCATTCGACAT
GAAGATGAAACATATTCAAGATTTGATGAGTCTCATTTTCAGAGAACATTTGATGAAAAG
ACATATTTGTCTTGGTTAGCTCAAGTTGGTTTTAAACATGTTGAAACATTTACTGATTTT
AATATAGATGAACATAATGAAGATGCAGAAAGATTGTTTTTCATTGCGAAAAAATAA60
120
180
240
300
360
420
480
540
600
660
717
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1647 [new locus tag: SACOL_RS08400 ]
- symbol: SACOL1647
- description: hypothetical protein
- length: 238
- theoretical pI: 4.09468
- theoretical MW: 27701.7
- GRAVY: -0.262605
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 48.3)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 42.8)and 17 moreBiosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 34.9)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 33.5)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 32.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 25.5)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 24.2)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 22.1)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 21.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 20.9)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 17.8)Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 17.3)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 15.8)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 15.7)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 14.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 14.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)
- TheSEED :
- FIG145533: Methyltransferase (EC 2.1.1.-)
- PFAM: NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 60.7)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 49.4)and 14 moreMethyltransf_12; Methyltransferase domain (PF08242; HMM-score: 47.3)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 46)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 40.6)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 37.8)Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 29.5)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 25.1)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 21.6)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 21.1)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 20.6)MTS; Methyltransferase small domain (PF05175; HMM-score: 19.9)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 17.1)Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 15.7)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 13.7)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9971
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0
- Extracellular Score: 0.0026
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016832
- TAT(Tat/SPI): 0.0002
- LIPO(Sec/SPII): 0.000493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGMDLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVYHHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRHEDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: comEA < SACOL1647 < SACOL1648 < SACOL1649 < nadD < SACOL1651 < aroE < SACOL1653 < SACOL1654 < mtn
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 8.75 h [3]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)