Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
- pan locus tag?: SAUPAN004184000
- symbol: SACOL1654
- pan gene symbol?: —
- synonym:
- product: HAD superfamily hydrolase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
- symbol: SACOL1654
- product: HAD superfamily hydrolase
- replicon: chromosome
- strand: -
- coordinates: 1683312..1683839
- length: 528
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236251 NCBI
- RefSeq: YP_186494 NCBI
- BioCyc: see SACOL_RS08435
- MicrobesOnline: 913103 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGGGTTTAGTTCGCAAGTTTTTTATGCCGAATTCATATGTTCAATCAATATTTCAAATT
GATTTAGACAAGTTAGTGGACAAAGGCGTTAAAGGTATTATTACAGATTTAGATAATACG
CTAGTAGGTTGGGATGTTAAAGAACCTACAGAACGTGTTAAAGCATGGTTTAAGGAAGCT
AATGAAAAAGGAATCACTATTACAATCGTGTCTAATAATAATGAGTCTCGTGTTGCTAGT
TTTAGTCAGCATTTAGACATCGATTTTATTTTTAAAGCGAGAAAGCCAATGGGGAAAGCG
TTTGATAAAGCAATAACTAAGATGAATATCAGACCAGATCAAACTGTTGTTATAGGTGAC
CAAATGCTTACTGATGTATTTGGTGGTAATCGTCGAGGTCTATATACAATTATGGTTGTT
CCAGTTAAACGAACTGATGGCTTTATTACTAAGTTTAATAGATTAATTGAAAGACGATTA
TTACGTCATTTCAGTAAAAAAGGTTATATCACATGGGAGGAAAATTGA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1654 [new locus tag: SACOL_RS08435 ]
- symbol: SACOL1654
- description: HAD superfamily hydrolase
- length: 175
- theoretical pI: 10.4084
- theoretical MW: 20219.4
- GRAVY: -0.305714
⊟Function[edit | edit source]
- TIGRFAM: HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 166.3)and 27 moreUnknown function Enzymes of unknown specificity HAD hydrolase, family IIIA (TIGR01662; HMM-score: 81.4)HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 40.4)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIA (TIGR01460; HMM-score: 34.5)Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 34.2)noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 31.3)phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 29.8)HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 29)Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 26.1)Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 23.6)Unknown function Enzymes of unknown specificity HAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 23.4)histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 22.9)Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 22.2)HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 22)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 21.4)Unknown function Enzymes of unknown specificity HAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 21.2)Unknown function Enzymes of unknown specificity HAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 21)HAD phosphatase, family IIIC (TIGR01681; HMM-score: 18.8)mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 18.1)HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 15.9)FkbH domain (TIGR01686; HMM-score: 15.9)sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 15)mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 14.8)beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 14.5)haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 13.8)pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.5)Energy metabolism Biosynthesis and degradation of polysaccharides beta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 12.1)sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 11.7)
- TheSEED :
- FIG001553: Hydrolase, HAD subfamily IIIA
- PFAM: HAD (CL0137) Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 44.9)Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 39.5)HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 37.8)and 6 morePGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 34.9)Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 33.7)Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 20.1)E-set (CL0159) BsuPI; Intracellular proteinase inhibitor (PF12690; HMM-score: 14.1)HAD (CL0137) S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 13.6)no clan defined DUF6305; Domain of unknown function (DUF6305) (PF19823; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.171
- Cytoplasmic Membrane Score: 0.8191
- Cell wall & surface Score: 0
- Extracellular Score: 0.0098
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003078
- TAT(Tat/SPI): 0.000147
- LIPO(Sec/SPII): 0.000352
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEANEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGDQMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 61 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: comEA < SACOL1647 < SACOL1648 < SACOL1649 < nadD < SACOL1651 < aroE < SACOL1653 < SACOL1654 < mtn
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)