Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01694
- pan locus tag?: SAUPAN004177000
- symbol: SAOUHSC_01694
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01694
- symbol: SAOUHSC_01694
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1604918..1605634
- length: 717
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921806 NCBI
- RefSeq: YP_500204 NCBI
- BioCyc: G1I0R-1575 BioCyc
- MicrobesOnline: 1290118 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCGCAATATGCAGAAATGAGCCTAGTGTACGATCAATTGACTCAAGATCAACCATAT
GAAAAATGGTTTGAAATTGTAAAAAATCACTGCAAAGATGAATCAAATATTTTAGATATT
GGATGCGGTACTGGTAGTTTAACAGTTCAATTAGAAGCTTTAGGTAATGTTACTGGTATG
GATTTAAGTGTTGATATGTTGACTGTTGCAGCTCAAAAATCAGCAAATGTAAATTGGCTT
GAAGGAGATATGACATCTTTTGATTTGCAACAACAATTTGATATCATCACTATTTTTTGT
GACTCTCTAAATTATTTGCAAGATGAAACTGCAGTGATTGAAACATTCATCAATGTTTAT
CATCATCTGACTGATTCAGGTGTATTTATTTTTGATGTACATACTGTTTATAAAATGATG
ACTTTGTTTAATAATCAAAGTTATATTGATGATAAAGGGGACATTTTTTTAGCATGGGAT
GCTGTGCAAGGAGATTTACCTTTAAGTGTTTATCATGATATGACATTTTTCATTCGACAT
GAAGATGAAACATATTCAAGATTTGATGAGTCTCATTTTCAGAGAACATTTGATGAAAAG
ACATATTTGTCTTGGTTAGCTCAAGTTGGTTTTAAACATGTTGAAACATTTACTGATTTT
AATATAGATGAACATAATGAAGATGCAGAAAGATTGTTTTTCATTGCGAAAAAATAA60
120
180
240
300
360
420
480
540
600
660
717
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01694
- symbol: SAOUHSC_01694
- description: hypothetical protein
- length: 238
- theoretical pI: 4.09468
- theoretical MW: 27701.7
- GRAVY: -0.262605
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 48.3)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 42.8)and 17 moreBiosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 34.9)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 33.5)Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 32.5)Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 25.5)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone demethylmenaquinone methyltransferase (TIGR02752; EC 2.1.1.163; HMM-score: 24.2)Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 22.1)Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 21.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 20.9)Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 17.8)Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 17.8)Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 17.3)methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 15.8)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 15.7)Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 14.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative sugar O-methyltransferase (TIGR04371; EC 2.1.1.-; HMM-score: 14.3)2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 11.8)
- TheSEED :
- FIG145533: Methyltransferase (EC 2.1.1.-)
- PFAM: NADP_Rossmann (CL0063) Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 60.7)Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 49.4)and 14 moreMethyltransf_12; Methyltransferase domain (PF08242; HMM-score: 47.3)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 46)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 40.6)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 37.8)Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 29.5)MetW; Methionine biosynthesis protein MetW (PF07021; HMM-score: 25.1)RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 21.6)FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 21.1)PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 20.6)MTS; Methyltransferase small domain (PF05175; HMM-score: 19.9)CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 17.1)Methyltransf_32; Methyltransferase domain (PF13679; HMM-score: 15.7)PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 13.7)Methyltransf_8; Hypothetical methyltransferase (PF05148; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9971
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0
- Extracellular Score: 0.0026
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016832
- TAT(Tat/SPI): 0.0002
- LIPO(Sec/SPII): 0.000493
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSQYAEMSLVYDQLTQDQPYEKWFEIVKNHCKDESNILDIGCGTGSLTVQLEALGNVTGMDLSVDMLTVAAQKSANVNWLEGDMTSFDLQQQFDIITIFCDSLNYLQDETAVIETFINVYHHLTDSGVFIFDVHTVYKMMTLFNNQSYIDDKGDIFLAWDAVQGDLPLSVYHDMTFFIRHEDETYSRFDESHFQRTFDEKTYLSWLAQVGFKHVETFTDFNIDEHNEDAERLFFIAKK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: holA < SAOUHSC_01691 < SAOUHSC_01692 < SAOUHSC_01693 < SAOUHSC_01694 < SAOUHSC_01695 < SAOUHSC_01696 < SAOUHSC_01697 < SAOUHSC_01698 < SAOUHSC_01699 < SAOUHSC_01700 < SAOUHSC_01701 < SAOUHSC_01702predicted SigA promoter [3] : SAOUHSC_01694 < SAOUHSC_01695 < SAOUHSC_01696 < SAOUHSC_01697 < SAOUHSC_01698 < SAOUHSC_01699 < SAOUHSC_01700 < SAOUHSC_01701 < SAOUHSC_01702
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)