Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
- pan locus tag?: SAUPAN001442000
- symbol: ssb1
- pan gene symbol?: ssb1
- synonym:
- product: prophage L54a, single-stranded DNA binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
- symbol: ssb1
- product: prophage L54a, single-stranded DNA binding protein
- replicon: chromosome
- strand: +
- coordinates: 363651..364070
- length: 420
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3236901 NCBI
- RefSeq: YP_185231 NCBI
- BioCyc: see SACOL_RS01705
- MicrobesOnline: 911810 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTAAACAGAACAGTATTAGTAGGGCGATTAACAAAAGACCCAGAATTAAGAAGCACG
CCAAATGGCGTAAATGTAGGGACATTCACATTAGCAGTAAACAGAACATTTACAAATGCT
CAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTATTCAAAAAACAAGCTGAAAAC
GTTAAAAACTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGGCGATTACAAACACGC
AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTT
CAATTCTTAGAACCGAAGAATAACAACAAACAGAATAACCAACAACACAACGGACAAACT
CAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACTTTTCTGACTTACCGTTCTGA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
- symbol: Ssb1
- description: prophage L54a, single-stranded DNA binding protein
- length: 139
- theoretical pI: 7.53655
- theoretical MW: 15608.1
- GRAVY: -0.815108
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 140.6)and 1 moreDNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 34.2)
- TheSEED :
- Single-stranded DNA-binding protein
and 1 more - PFAM: OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 123)and 1 moretRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 20.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010636
- TAT(Tat/SPI): 0.001159
- LIPO(Sec/SPII): 0.001559
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p)