From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
  • pan locus tag?: SAUPAN001442000
  • symbol: ssb1
  • pan gene symbol?: ssb1
  • synonym:
  • product: prophage L54a, single-stranded DNA binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
  • symbol: ssb1
  • product: prophage L54a, single-stranded DNA binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 363651..364070
  • length: 420
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGTTAAACAGAACAGTATTAGTAGGGCGATTAACAAAAGACCCAGAATTAAGAAGCACG
    CCAAATGGCGTAAATGTAGGGACATTCACATTAGCAGTAAACAGAACATTTACAAATGCT
    CAAGGCGAGCGTGAAGCAGACTTTATAAACGTAGTAGTATTCAAAAAACAAGCTGAAAAC
    GTTAAAAACTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGGCGATTACAAACACGC
    AGTTACGATAACAAAGAAGGGCGACGTGTATTTGTGACAGAAGTAGTAGCGGACAGCGTT
    CAATTCTTAGAACCGAAGAATAACAACAAACAGAATAACCAACAACACAACGGACAAACT
    CAAACTGGTAATAATCCGTTCGACAATACCGAAGAAGACTTTTCTGACTTACCGTTCTGA
    60
    120
    180
    240
    300
    360
    420

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0339 [new locus tag: SACOL_RS01705 ]
  • symbol: Ssb1
  • description: prophage L54a, single-stranded DNA binding protein
  • length: 139
  • theoretical pI: 7.53655
  • theoretical MW: 15608.1
  • GRAVY: -0.815108

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 140.6)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 34.2)
  • TheSEED  :
    • Single-stranded DNA-binding protein
    DNA Metabolism DNA repair DNA repair, bacterial  Single-stranded DNA-binding protein
    and 1 more
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  Single-stranded DNA-binding protein
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 123)
    and 1 more
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 20.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010636
    • TAT(Tat/SPI): 0.001159
    • LIPO(Sec/SPII): 0.001559
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTRSYDNKEGRRVFVTEVVADSVQFLEPKNNNKQNNQQHNGQTQTGNNPFDNTEEDFSDLPF

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]