Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
- pan locus tag?: SAUPAN001453000
- symbol: SACOL0349
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
- symbol: SACOL0349
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 368608..368865
- length: 258
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236911 NCBI
- RefSeq: YP_185241 NCBI
- BioCyc: see SACOL_RS01755
- MicrobesOnline: 911820 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAGTTGAACGAAGTATTCGCAACTAATTTAAGAGTAATCATGGCTAGAGATAACGTA
AGTGTTCAAGATTTGCACAATGAAACTGGCGTATCAAGATCAACTATTAGTGGATATAAA
AACGGAAAAGCTGAGATGGTTAACTTAAATGTATTAGATAAATTGGCAGATGCTCTAGGT
GTTAATGTAAGTGAACTATTTACTAGAAATCACAACACGCACAAATTAGAGGATTGGATT
AAAAAAGTAAATGTATAG60
120
180
240
258
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0349 [new locus tag: SACOL_RS01755 ]
- symbol: SACOL0349
- description: hypothetical protein
- length: 85
- theoretical pI: 9.11945
- theoretical MW: 9565.85
- GRAVY: -0.341176
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 15.1)
- TheSEED :
- Phage transcriptional regulator cro
- PFAM: HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 59.8)and 14 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 34.9)HTH_3; Helix-turn-helix (PF01381; HMM-score: 32.2)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 31.6)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 22.5)HTH_11; HTH domain (PF08279; HMM-score: 20.1)TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 16.7)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 15.1)Met_repress (CL0057) RHH_1; Ribbon-helix-helix protein, copG family (PF01402; HMM-score: 14.6)HTH (CL0123) HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 14.4)MarR_2; MarR family (PF12802; HMM-score: 13.1)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.9)MarR; MarR family (PF01047; HMM-score: 12.6)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 12.4)Met_repress (CL0057) RHH_3; Ribbon-helix-helix domain (PF12651; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00715
- TAT(Tat/SPI): 0.000363
- LIPO(Sec/SPII): 0.000844
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLNEVFATNLRVIMARDNVSVQDLHNETGVSRSTISGYKNGKAEMVNLNVLDKLADALGVNVSELFTRNHNTHKLEDWIKKVNV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.