Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
- pan locus tag?:
- symbol: SACOL0355
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
- symbol: SACOL0355
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 370444..370752
- length: 309
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3236922 NCBI
- RefSeq: YP_185247 NCBI
- BioCyc: see SACOL_RS01785
- MicrobesOnline: 911826 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACGTTCACCTTATCAGATGAACAATATAAAAATCTTTGTACTAACTCTAACAAGTTA
TTAGATAAACTTCACAAAGCATTAAAAGATCGTGAAGAGTACAAGAAGCAACGAGATGAG
CTTATTGGGGATATAGCGAAGTTACGAGATTGTAACAAAGAACTGGAGAAGAAAGCAAGC
GCATGGGATAGGTATTGCAAGAGCGTTGAAAAAGATTTAATAAACGAATTCGGTAACGAT
GATGAAAGAGTTAAATTCGGAATGGAATTAAACAATAAAATTTTTATGGAGGATGACACA
AATGAATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0355 [new locus tag: SACOL_RS01785 ]
- symbol: SACOL0355
- description: hypothetical protein
- length: 102
- theoretical pI: 4.85853
- theoretical MW: 12143.6
- GRAVY: -1.16569
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical protein, SAB1734c homolog [SA bacteriophages 11, Mu50B]
- PFAM: no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 19.7)and 6 moreLOH1CR12; Tumour suppressor protein (PF10158; HMM-score: 14.8)NYD-SP28_assoc; Sperm tail C-terminal domain (PF14775; HMM-score: 14.5)CENP-H; Centromere protein H (CENP-H) (PF05837; HMM-score: 14.4)Peptidase_MA (CL0126) Peptidase_M3; Peptidase family M3 (PF01432; HMM-score: 14)no clan defined MCU; Mitochondrial calcium uniporter (PF04678; HMM-score: 12.4)DUF2330; Uncharacterized protein conserved in bacteria (DUF2330) (PF10092; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005526
- TAT(Tat/SPI): 0.000572
- LIPO(Sec/SPII): 0.001264
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTFTLSDEQYKNLCTNSNKLLDKLHKALKDREEYKKQRDELIGDIAKLRDCNKELEKKASAWDRYCKSVEKDLINEFGNDDERVKFGMELNNKIFMEDDTNE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.