From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_002118
  • pan locus tag?: SAUPAN005498000
  • symbol: JSNZ_002118
  • pan gene symbol?: mtlF
  • synonym:
  • product: PTS sugar transporter subunit IIA

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_002118
  • symbol: JSNZ_002118
  • product: PTS sugar transporter subunit IIA
  • replicon: chromosome
  • strand: +
  • coordinates: 2131076..2131510
  • length: 435
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGCGAATTATTTAGTAATGACAATATCTTTTTAAATGTAAATGTTAACAGCCAAAAT
    GAAGCAATTGAAAAAGCAGGTAAAGCCTTAGTTGATAGTGGTGCTGTAACAGATGCTTAT
    ATTCAAGCAATGAAAGATCGTGAGCAAGTCGTATCAACATTTATGGGAAATGGCTTAGCA
    ATTCCTCATGGCACAGATGAAGCTAAAACAAATGTTATTCACTCAGGTTTAACATTATTA
    CAAATCCCTGAAGGCGTTGACTGGGATGGCGAAGTAGTTAAAGTTGTCGTGGGAATTGCT
    GGTAAAGATGGCGAACATTTAGACTTGTTATCTAAAATTGCAATTACATTTAGCGAAGAA
    GAAAATGTGGATCGTATCGTTCAAGCAAAATCTGCAGAAGAAATTAAACAAGTATTCGAG
    GAGGCAGATGCATAA
    60
    120
    180
    240
    300
    360
    420
    435

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_002118
  • symbol: JSNZ_002118
  • description: PTS sugar transporter subunit IIA
  • length: 144
  • theoretical pI: 4.0989
  • theoretical MW: 15542.3
  • GRAVY: -0.130556

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)
    Signal transduction Signal transduction PTS PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)
    and 1 more
    Signal transduction Signal transduction PTS PTS IIA-like nitrogen-regulatory protein PtsN (TIGR01419; HMM-score: 49.7)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 125.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.999
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0004
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00765
    • TAT(Tat/SPI): 0.000711
    • LIPO(Sec/SPII): 0.000476
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLAIPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVQAKSAEEIKQVFEEADA

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: MtlR* (activation) regulon, SigB (activation) regulon
    MtlR*(TF)important in Mannitol utilization;  regulation predicted or transferred from N315 and NCTC 8325  [2]
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  regulation predicted or transferred from N315 and NCTC 8325  [3] [4] [5]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)
  3. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  5. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_002118&oldid=107759"