Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
- pan locus tag?: SAUPAN005498000
- symbol: mtlA
- pan gene symbol?: mtlF
- synonym:
- product: mannitol-specific IIA component
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
- symbol: mtlA
- product: mannitol-specific IIA component
- replicon: chromosome
- strand: +
- coordinates: 2280913..2281347
- length: 435
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331256 NCBI
- RefSeq: YP_001333093 NCBI
- BioCyc:
- MicrobesOnline: 3707652 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGCGAATTATTTAGTAATGACAATATCTTTTTAAATGTAAATGTTAACAGCCAAAAT
GAAGCAATTGAAAAAGCAGGTAAAGCCTTAGTTGATAGTGGTGCTGTAACAGATGCTTAT
ATTCAAGCAATGAAAGATCGTGAGCAAGTCGTATCAACATTTATGGGAAATGGCTTAGCA
ATTCCTCATGGCACAGATGAAGCTAAAACAAATGTGATTCACTCAGGTTTAACATTATTA
CAAATCCCTGAAGGCGTTGACTGGGATGGCGAAGTAGTTAAAGTTGTCGTGGGAATTGCT
GGTAAAGATGGCGAACATTTAGACTTGTTATCTAAAATTGCAATTACATTTAGCGAAGAA
GAAAATGTGGATCGTATCGTTCAAGCAAAATCTGCAGAAGAAATTAAACAAGTATTCGAG
GAGGCAGATGCATAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2059 [new locus tag: NWMN_RS11890 ]
- symbol: MtlA
- description: mannitol-specific IIA component
- length: 144
- theoretical pI: 4.0989
- theoretical MW: 15542.3
- GRAVY: -0.130556
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)Signal transduction PTS PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)and 1 moreSignal transduction PTS PTS IIA-like nitrogen-regulatory protein PtsN (TIGR01419; HMM-score: 49.7)
- TheSEED :
- PTS system, mannitol-specific IIA component (EC 2.7.1.197)
- PFAM: PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 125.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.999
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00765
- TAT(Tat/SPI): 0.000711
- LIPO(Sec/SPII): 0.000476
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLAIPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVQAKSAEEIKQVFEEADA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: mtlF > NWMN_2058 > mtlA > mtlD
⊟Regulation[edit | edit source]
- regulators: MtlR* (activation) regulon, SigB (activation) regulon
MtlR* (TF) important in Mannitol utilization; RegPrecise transcription unit transferred from N315 data RegPrecise SigB (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [1] [2] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
J Bacteriol: 2011, 193(18);4954-62
[PubMed:21725011] [WorldCat.org] [DOI] (I p)