Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2148 [new locus tag: SACOL_RS11245 ]
- pan locus tag?: SAUPAN005498000
- symbol: SACOL2148
- pan gene symbol?: mtlF
- synonym:
- product: PTS system, mannitol-specific IIA component
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2148 [new locus tag: SACOL_RS11245 ]
- symbol: SACOL2148
- product: PTS system, mannitol-specific IIA component
- replicon: chromosome
- strand: +
- coordinates: 2212530..2212964
- length: 435
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237440 NCBI
- RefSeq: YP_186961 NCBI
- BioCyc: see SACOL_RS11245
- MicrobesOnline: 913624 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGCGAATTATTTAGTAATGACAATATCTTTTTAAATGTAAATGTTAACAGCCAAAAT
GAAGCAATTGAAAAAGCAGGTAAAGCCTTAGTTGATAGTGGTGCTGTAACAGATGCTTAT
ATTCAAGCAATGAAAGATCGTGAGCAAGTCGTATCAACATTTATGGGAAATGGCTTAGCA
ATTCCTCATGGCACAGATGAAGCTAAAACAAATGTGATTCACTCAGGTTTAACATTATTA
CAAATCCCTGAAGGCGTTGACTGGGATGGCGAAGTAGTTAAAGTTGTCGTGGGAATTGCT
GGTAAAGATGGCGAACATTTAGACTTGTTATCTAAAATTGCAATTACATTTAGCGAAGAA
GAAAATGTGGATCGTATCGTTCAAGCAAAATCTGCAGAAGAAATTAAACAAGTATTCGAG
GAGGCAGATGCATAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2148 [new locus tag: SACOL_RS11245 ]
- symbol: SACOL2148
- description: PTS system, mannitol-specific IIA component
- length: 144
- theoretical pI: 4.0989
- theoretical MW: 15542.3
- GRAVY: -0.130556
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)Signal transduction PTS PTS system, fructose subfamily, IIA component (TIGR00848; EC 2.7.1.69; HMM-score: 66.6)and 1 moreSignal transduction PTS PTS IIA-like nitrogen-regulatory protein PtsN (TIGR01419; HMM-score: 49.7)
- TheSEED :
- PTS system, mannitol-specific IIA component (EC 2.7.1.197)
- PFAM: PTase-anion_tr (CL0340) PTS_EIIA_2; Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 (PF00359; HMM-score: 125.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.999
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00765
- TAT(Tat/SPI): 0.000711
- LIPO(Sec/SPII): 0.000476
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSELFSNDNIFLNVNVNSQNEAIEKAGKALVDSGAVTDAYIQAMKDREQVVSTFMGNGLAIPHGTDEAKTNVIHSGLTLLQIPEGVDWDGEVVKVVVGIAGKDGEHLDLLSKIAITFSEEENVDRIVQAKSAEEIKQVFEEADA
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 870 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: MtlR* (activation) regulon, SigB* (activation) regulon
MtlR* (TF) important in Mannitol utilization; RegPrecise transcription unit transferred from N315 data RegPrecise SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [5] [6] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 75.32 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
