From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000447
  • pan locus tag?: SAUPAN002248000
  • symbol: divIC
  • pan gene symbol?: divIC
  • synonym:
  • product: cell division protein DivIC

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000447
  • symbol: divIC
  • product: cell division protein DivIC
  • replicon: chromosome
  • strand: +
  • coordinates: 479680..480072
  • length: 393
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAATAAAGTAGAACATATAGAAAATCAGTACACGTCGCAAGAGAACAAGAAAAAA
    CAACGTCAAAAAATGAAAATGCGTGTTGTTCGTAGGCGTATTACAGTATTTGCAGGCGTA
    TTACTTGCGATAATTGTTGTTTTATCAATCTTGCTTGTTGTCCAAAAACATCGCAATGAT
    ATCGATGCACAGGAGCGAAAAGCGAAAGAAGCACAGTTTCAAAAGCAACAAAATGAAGAA
    ATTGCGTTAAAAGAAAAGTTGAATAATCTGAATGACAAAGATTATATTGAAAAAATTGCG
    CGTGATGATTATTACTTAAGCAACAAAGGTGAAGTGATTTTTAGGTTGCCAGAAGACAAA
    GATTCGTCTAGCTCAAAATCTTCGAAAAAATAA
    60
    120
    180
    240
    300
    360
    393

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000447
  • symbol: DivIC
  • description: cell division protein DivIC
  • length: 130
  • theoretical pI: 10.4495
  • theoretical MW: 15347.6
  • GRAVY: -0.941538

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 22)
    and 4 more
    cytochrome c oxidase accessory protein CcoG (TIGR02745; HMM-score: 16.6)
    TIGR03943 family protein (TIGR03943; HMM-score: 13.3)
    Genetic information processing Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
    Metabolism Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 68.6)
    and 15 more
    TRAP (CL0757) SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 16.3)
    TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.9)
    no clan defined Gemini_AL2; Geminivirus AL2 protein (PF01440; HMM-score: 15.5)
    DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 14.9)
    TRAP_alpha; Translocon-associated protein (TRAP), alpha subunit (PF03896; HMM-score: 13.9)
    EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 13.5)
    INSIG-like (CL0798) INSIG; Insulin-induced protein (INSIG) (PF07281; HMM-score: 12.3)
    HTH (CL0123) WH_AprA; AprA winged helix domain (PF23589; HMM-score: 12.2)
    no clan defined LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 12.1)
    MASE10; MASE10 (PF20970; HMM-score: 12.1)
    GPCR_A (CL0192) Frizzled; Frizzled/Smoothened family membrane region (PF01534; HMM-score: 10.5)
    Omega_toxin (CL0083) Conotoxin; Conotoxin (PF02950; HMM-score: 10.5)
    YhhM-like (CL0851) DUF2500; Protein of unknown function (DUF2500) (PF10694; HMM-score: 9.4)
    no clan defined Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 8.3)
    UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 7.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017308
    • TAT(Tat/SPI): 0.000593
    • LIPO(Sec/SPII): 0.005031
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDKDSSSSKSSKK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]