From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00482
  • pan locus tag?: SAUPAN002248000
  • symbol: SAOUHSC_00482
  • pan gene symbol?: divIC
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00482
  • symbol: SAOUHSC_00482
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 480218..480610
  • length: 393
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAATAAAGTAGAACATATAGAAAATCAGTACACGTCGCAAGAGAACAAGAAAAAA
    CAACGTCAAAAAATGAAAATGCGTGTTGTTCGTAGGCGTATTACAGTATTTGCGGGCGTA
    TTACTTGCGATAATTGTTGTTTTATCAATCTTGCTTGTTGTCCAAAAACATCGCAATGAT
    ATTGATGCACAGGAGCGAAAAGCGAAAGAAGCACAGTTTCAAAAGCAACAAAATGAAGAA
    ATTGCGTTAAAAGAAAAGTTGAATAATCTGAATGACAAAGATTACATTGAAAAAATTGCG
    CGTGATGATTATTACTTAAGCAACAAAGGTGAAGTGATTTTTAGGTTGCCAGAAGACAAA
    GATTCGTCTAGCTCAAAATCTTCGAAAAAATAA
    60
    120
    180
    240
    300
    360
    393

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00482
  • symbol: SAOUHSC_00482
  • description: hypothetical protein
  • length: 130
  • theoretical pI: 10.4495
  • theoretical MW: 15347.6
  • GRAVY: -0.941538

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division cell division protein FtsL (TIGR02209; HMM-score: 22)
    and 4 more
    cytochrome c oxidase accessory protein CcoG (TIGR02745; HMM-score: 16.6)
    TIGR03943 family protein (TIGR03943; HMM-score: 13.3)
    Genetic information processing Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
    Metabolism Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
  • TheSEED  :
    • Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage
    Bacterial Cell Division  Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage
    and 2 more
    Cell division-ribosomal stress proteins cluster  Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage
    RP Bacterial Cell Division  Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage
  • PFAM:
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 66.4)
    and 23 more
    FtsL; Cell division protein FtsL (PF04999; HMM-score: 15.8)
    no clan defined Gemini_AL2; Geminivirus AL2 protein (PF01440; HMM-score: 15.5)
    EphA2_TM; Ephrin type-A receptor 2 transmembrane domain (PF14575; HMM-score: 15.2)
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 15)
    SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 14.8)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 14.5)
    LapA_dom; Lipopolysaccharide assembly protein A domain (PF06305; HMM-score: 13.3)
    Protocadherin; Protocadherin (PF08374; HMM-score: 13.2)
    DUF1191; Protein of unknown function (DUF1191) (PF06697; HMM-score: 13.1)
    Peptidase_MA (CL0126) Peptidase_M50; Peptidase family M50 (PF02163; HMM-score: 12.7)
    no clan defined INSIG; Insulin-induced protein (INSIG) (PF07281; HMM-score: 11.9)
    GPCR_A (CL0192) 7tm_1; 7 transmembrane receptor (rhodopsin family) (PF00001; HMM-score: 10.8)
    Frizzled; Frizzled/Smoothened family membrane region (PF01534; HMM-score: 10.5)
    MFS (CL0015) TLC; TLC ATP/ADP transporter (PF03219; HMM-score: 10.2)
    no clan defined TraG_N; TraG-like protein, N-terminal region (PF07916; HMM-score: 9.8)
    SNARE-fusion (CL0445) Synaptobrevin; Synaptobrevin (PF00957; HMM-score: 9.7)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 9.1)
    no clan defined Baculo_11_kDa; Baculovirus 11 kDa family (PF06143; HMM-score: 9)
    DUF2500; Protein of unknown function (DUF2500) (PF10694; HMM-score: 8.7)
    O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 8.5)
    no clan defined UPF0239; Uncharacterised protein family (UPF0239) (PF06783; HMM-score: 8.2)
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 7.2)
    Oxa1 (CL0376) 60KD_IMP; 60Kd inner membrane protein (PF02096; HMM-score: 6.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 0.53
    • Cellwall Score: 8.75
    • Extracellular Score: 0.7
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 4
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017308
    • TAT(Tat/SPI): 0.000593
    • LIPO(Sec/SPII): 0.005031
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKNKVEHIENQYTSQENKKKQRQKMKMRVVRRRITVFAGVLLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNLNDKDYIEKIARDDYYLSNKGEVIFRLPEDKDSSSSKSSKK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_00482&oldid=89086"