Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03070 [old locus tag: SACOL0592 ]
  • pan locus tag?: SAUPAN002318000
  • symbol: SACOL_RS03070
  • pan gene symbol?: rpsG
  • synonym:
  • product: 30S ribosomal protein S7

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS03070 [old locus tag: SACOL0592 ]
  • symbol: SACOL_RS03070
  • product: 30S ribosomal protein S7
  • replicon: chromosome
  • strand: +
  • coordinates: 615267..615737
  • length: 471
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (615267..615737) NCBI
  • BioCyc: SACOL_RS03070 BioCyc
  • MicrobesOnline: see SACOL0592

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCCTCGTAAAGGATCAGTACCTAAAAGAGACGTATTACCAGATCCAATTCATAACTCT
    AAGTTAGTAACTAAATTAATTAACAAAATTATGTTAGATGGTAAACGTGGAACAGCACAA
    AGAATTCTTTATTCAGCATTCGACCTAGTTGAACAACGCAGTGGTCGTGATGCATTAGAA
    GTATTCGAAGAAGCAATCAACAACATTATGCCAGTATTAGAAGTTAAAGCTCGTCGCGTA
    GGTGGTTCTAACTATCAAGTACCAGTAGAAGTTCGTCCAGAGCGTCGTACTACTTTAGGT
    TTACGTTGGTTAGTTAACTATGCACGTCTTCGTGGTGAAAAAACGATGGAAGATCGTTTA
    GCTAACGAAATTTTAGATGCAGCAAATAATACAGGTGGTGCCGTTAAGAAACGTGAGGAC
    ACTCACAAAATGGCTGAAGCAAACAAAGCATTTGCTCACTACCGTTGGTAA
    60
    120
    180
    240
    300
    360
    420
    471

⊟Protein[edit | edit source]

  • 5LI0
    PDB
  • 5ND8
    PDB
  • 5ND9
    PDB
  • 5TCU
    PDB
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: SACOL_RS03070 [old locus tag: SACOL0592 ]
  • symbol: SACOL_RS03070
  • description: 30S ribosomal protein S7
  • length: 156
  • theoretical pI: 10.6134
  • theoretical MW: 17794.4
  • GRAVY: -0.622436

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS7 (TIGR01029; HMM-score: 230.3)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS7 (TIGR01028; HMM-score: 66)
  • TheSEED: see SACOL0592
  • PFAM:
    no clan defined Ribosomal_S7; Ribosomal protein S7p/S5e (PF00177; HMM-score: 226.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.3674
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.6316
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001772
    • TAT(Tat/SPI): 0.000201
    • LIPO(Sec/SPII): 0.000209
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 447060239 NCBI
  • RefSeq: WP_001137495 NCBI
  • UniProt: see SACOL0592

⊟Protein sequence[edit | edit source]

  • MPRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALEVFEEAINNIMPVLEVKARRVGGSNYQVPVEVRPERRTTLGLRWLVNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW

⊟Experimental data[edit | edit source]

  • experimentally validated: see SACOL0592
  • protein localization: see SACOL0592
  • quantitative data / protein copy number per cell: see SACOL0592
  • ⊟interaction partners:
    SACOL_RS00880indolepyruvate decarboxylase  [1] (data from MRSA252)
    SACOL_RS015305'-nucleotidase, lipoprotein e(P4) family  [1] (data from MRSA252)
    SACOL_RS0220030S ribosomal protein S6  [1] (data from MRSA252)
    SACOL_RS0221030S ribosomal protein S18  [1] (data from MRSA252)
    SACOL_RS02825RNA-binding protein S1  [1] (data from MRSA252)
    SACOL_RS0303050S ribosomal protein L1  [1] (data from MRSA252)
    SACOL_RS0304050S ribosomal protein L7/L12  [1] (data from MRSA252)
    SACOL_RS03755LysR family transcriptional regulator  [1] (data from MRSA252)
    SACOL_RS03810hypothetical protein  [1] (data from MRSA252)
    SACOL_RS04195preprotein translocase subunit SecA  [1] (data from MRSA252)
    SACOL_RS04310aldehyde dehydrogenase  [1] (data from MRSA252)
    SACOL_RS04330enolase  [1] (data from MRSA252)
    SACOL_RS04840NADH dehydrogenase  [1] (data from MRSA252)
    SACOL_RS05165NAD(+) kinase  [1] (data from MRSA252)
    SACOL_RS05630pyruvate dehydrogenase E1 component subunit alpha  [1] (data from MRSA252)
    SACOL_RS06135cell division protein FtsA  [1] (data from MRSA252)
    SACOL_RS0633050S ribosomal protein L28  [1] (data from MRSA252)
    SACOL_RS0642050S ribosomal protein L19  [1] (data from MRSA252)
    SACOL_RS0659530S ribosomal protein S15  [1] (data from MRSA252)
    SACOL_RS06605ribonuclease J 2  [1] (data from MRSA252)
    SACOL_RS07705DNA-binding protein HU  [1] (data from MRSA252)
    SACOL_RS0868050S ribosomal protein L21  [1] (data from MRSA252)
    SACOL_RS0882050S ribosomal protein L20  [1] (data from MRSA252)
    SACOL_RS08830translation initiation factor IF-3  [1] (data from MRSA252)
    SACOL_RS08905isocitrate dehydrogenase (NADP(+))  [1] (data from MRSA252)
    SACOL_RS08970universal stress protein  [1] (data from MRSA252)
    SACOL_RS0904530S ribosomal protein S4  [1] (data from MRSA252)
    SACOL_RS10210non-heme ferritin  [1] (data from MRSA252)
    SACOL_RS1161530S ribosomal protein S9  [1] (data from MRSA252)
    SACOL_RS1165530S ribosomal protein S11  [1] (data from MRSA252)
    SACOL_RS1166030S ribosomal protein S13  [1] (data from MRSA252)
    SACOL_RS1168550S ribosomal protein L15  [1] (data from MRSA252)
    SACOL_RS1169530S ribosomal protein S5  [1] (data from MRSA252)
    SACOL_RS1170050S ribosomal protein L18  [1] (data from MRSA252)
    SACOL_RS1170550S ribosomal protein L6  [1] (data from MRSA252)
    SACOL_RS1172050S ribosomal protein L5  [1] (data from MRSA252)
    SACOL_RS1173530S ribosomal protein S17  [1] (data from MRSA252)
    SACOL_RS1174550S ribosomal protein L16  [1] (data from MRSA252)
    SACOL_RS1175030S ribosomal protein S3  [1] (data from MRSA252)
    SACOL_RS1175550S ribosomal protein L22  [1] (data from MRSA252)
    SACOL_RS1176550S ribosomal protein L2  [1] (data from MRSA252)
    SACOL_RS1177050S ribosomal protein L23  [1] (data from MRSA252)
    SACOL_RS1177550S ribosomal protein L4  [1] (data from MRSA252)
    SACOL_RS1178050S ribosomal protein L3  [1] (data from MRSA252)
    SACOL_RS1178530S ribosomal protein S10  [1] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Jump up to: 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL_RS03070&oldid=78913"
  • This page was last edited on 11 March 2016, at 01:14.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again