From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00515
  • symbol: SAOUHSC_00515
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 516850..517419
  • length: 570
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAATACGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATGCAATAAATGAT
    AAAGACTTCGAAAAGTTAGTAATGGATCTACAACCATTAATTATTCGACGCATCAAAACA
    TTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAGAAATACTTATACGGATGTAT
    AGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
    TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATG
    GATAATTTGATTAATGAATATAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTT
    GAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGATTTGTCAGTTTAAGTATTTG
    AGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
    GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAAT
    AAAATAAAACGTTATTTCAAAATGATTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00515
  • symbol: SAOUHSC_00515
  • description: hypothetical protein
  • length: 189
  • theoretical pI: 9.43118
  • theoretical MW: 23028.8
  • GRAVY: -0.478836

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 53.2)
    and 17 more
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 29)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 25.2)
    RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 25.1)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 25.1)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 21)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 19.9)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 19.8)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.4)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 16.4)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 12.9)
  • TheSEED  :
    • RNA polymerase sporulation specific sigma factor SigH
    Dormancy and Sporulation Dormancy and Sporulation - no subcategory Sporulation-associated proteins with broader functions  RNA polymerase sporulation specific sigma factor SigH
    and 2 more
    Miscellaneous Plant-Prokaryote comparative genomics Conserved gene cluster possibly involved in RNA metabolism  RNA polymerase sporulation specific sigma factor SigH
    RNA Metabolism Transcription Transcription initiation, bacterial sigma factors  RNA polymerase sporulation specific sigma factor SigH
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 47)
    and 6 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.5)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 13.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.6)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.2)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.4)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by SigH*, sigma factor controlling competence and phage integrase genes [1]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8328
    • Cytoplasmic Membrane Score: 0.0634
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1022
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001521
    • TAT(Tat/SPI): 0.000208
    • LIPO(Sec/SPII): 0.000353
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKNKIKRYFKMI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser:  [2] 
    Expression Data Browser
    Multi-gene expression profiles



    Click on any data point to display a description of the corresponding condition!

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Liang Tao, Xiaoqian Wu, Baolin Sun
    Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
    PLoS Pathog: 2010, 6(5);e1000888
    [PubMed:20485515] [WorldCat.org] [DOI] (I e)
  2. Jump up to: 2.0 2.1 2.2 2.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
Genes Cells: 2003, 8(8);699-712
[PubMed:12875655] [WorldCat.org] [DOI] (P p)
Liang Tao, Xiaoqian Wu, Baolin Sun
Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
PLoS Pathog: 2010, 6(5);e1000888
[PubMed:20485515] [WorldCat.org] [DOI] (I e)
Kazuya Morikawa, Aya J Takemura, Yumiko Inose, Melody Tsai, Le Thuy Nguyen Thi, Toshiko Ohta, Tarek Msadek
Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus.
PLoS Pathog: 2012, 8(11);e1003003
[PubMed:23133387] [WorldCat.org] [DOI] (I p)

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00515
  • pan locus tag?: SAUPAN002302000
  • symbol: SAOUHSC_00515
  • pan gene symbol?: sigH
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00515
  • symbol: SAOUHSC_00515
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 516850..517419
  • length: 570
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAATACGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATGCAATAAATGAT
    AAAGACTTCGAAAAGTTAGTAATGGATCTACAACCATTAATTATTCGACGCATCAAAACA
    TTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAGAAATACTTATACGGATGTAT
    AGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
    TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATG
    GATAATTTGATTAATGAATATAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTT
    GAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGATTTGTCAGTTTAAGTATTTG
    AGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
    GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAAT
    AAAATAAAACGTTATTTCAAAATGATTTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    570

This data comes from external databases and cannot be edited.

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00515
  • symbol: SAOUHSC_00515
  • description: hypothetical protein
  • length: 189
  • theoretical pI: 9.43118
  • theoretical MW: 23028.8
  • GRAVY: -0.478836

Function[edit | edit source]

  • TIGRFAM:
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 53.2)
    and 17 more
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 29)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)
    RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 25.2)
    RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 25.1)
    RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 25.1)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)
    RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 21)
    RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 19.9)
    RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 19.8)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.4)
    RNA polymerase sigma-W factor (TIGR02948; HMM-score: 16.4)
    Cellular processes Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    Genetic information processing Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 15.4)
    RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 12.9)
  • TheSEED  :
    • RNA polymerase sporulation specific sigma factor SigH
    Dormancy and Sporulation Dormancy and Sporulation - no subcategory Sporulation-associated proteins with broader functions  RNA polymerase sporulation specific sigma factor SigH
    and 2 more
    Miscellaneous Plant-Prokaryote comparative genomics Conserved gene cluster possibly involved in RNA metabolism  RNA polymerase sporulation specific sigma factor SigH
    RNA Metabolism Transcription Transcription initiation, bacterial sigma factors  RNA polymerase sporulation specific sigma factor SigH
  • PFAM:
    HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 47)
    and 6 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.5)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 13.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.6)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.2)
    GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.4)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by SigH*, sigma factor controlling competence and phage integrase genes [1]

  1. Liang Tao, Xiaoqian Wu, Baolin Sun
    Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
    PLoS Pathog: 2010, 6(5);e1000888
    [PubMed:20485515] [WorldCat.org] [DOI] (I e)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8328
    • Cytoplasmic Membrane Score: 0.0634
    • Cell wall & surface Score: 0.0017
    • Extracellular Score: 0.1022
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001521
    • TAT(Tat/SPI): 0.000208
    • LIPO(Sec/SPII): 0.000353
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKNKIKRYFKMI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

  1. 1.0 1.1 1.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

  1. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Other Information[edit | edit source]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
Genes Cells: 2003, 8(8);699-712
[PubMed:12875655] [WorldCat.org] [DOI] (P p)
Liang Tao, Xiaoqian Wu, Baolin Sun
Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
PLoS Pathog: 2010, 6(5);e1000888
[PubMed:20485515] [WorldCat.org] [DOI] (I e)
Kazuya Morikawa, Aya J Takemura, Yumiko Inose, Melody Tsai, Le Thuy Nguyen Thi, Toshiko Ohta, Tarek Msadek
Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus.
PLoS Pathog: 2012, 8(11);e1003003
[PubMed:23133387] [WorldCat.org] [DOI] (I p)