⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
- pan locus tag?: SAUPAN002302000
- symbol: NWMN_0496
- pan gene symbol?: sigH
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
- symbol: NWMN_0496
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 570767..571336
- length: 570
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330263 NCBI
- RefSeq: YP_001331530 NCBI
- BioCyc:
- MicrobesOnline: 3706043 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541TTGAAATACGATTTGACAACTCAAGACAGTACAATCAAACGTAACAATGCAATAAATGAT
AAAGACTTCGAAAAGTTAGTAATGGATCTACAACCATTAATTATTCGACGCATCAAAACA
TTTGGATTTAATCATTATGATTTAGAAGACTTATATCAAGAAATACTTATACGGATGTAT
AGGTCGGTCCAAACATTTGATTTTAGTGGAGAGCAGCCTTTCACAAATTATGTTCAATGT
TTAATTACGTCTGTAAAGTATGATTATTTGAGAAAATATTTAGCTACAAATAAAAGAATG
GATAATTTGATTAATGAATATAGAGTTACGTATCCATGTGCAATAAAGCGTTTTGATGTT
GAAAACAATTATTTGAATAAATTAGCAATTAAAGAGTTGATTTGTCAGTTTAAGTATTTG
AGTGCATTTGAAAAAGATGTCATGTATTTAATGTGTGAACAATATAAGCCGAGAGAAATT
GCTCAATTGATGCATGTAAAAGAGAAAGTGATTTATAATGCCATACAACGATGTAAAAAT
AAAATAAAACGTTATTTCAAAATGATTTGA60
120
180
240
300
360
420
480
540
570
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0496 [new locus tag: NWMN_RS02895 ]
- symbol: NWMN_0496
- description: hypothetical protein
- length: 189
- theoretical pI: 9.43118
- theoretical MW: 23028.8
- GRAVY: -0.478836
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 53.2)and 17 moreRNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 29)Cellular processes Sporulation and germination RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)Transcription Transcription factors RNA polymerase sigma-H factor (TIGR02859; HMM-score: 27.8)RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 25.2)RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 25.1)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 25.1)Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 23.8)RNA polymerase sigma factor RpoE (TIGR02939; HMM-score: 21)RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 19.9)RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 19.8)RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 19.4)RNA polymerase sigma-W factor (TIGR02948; HMM-score: 16.4)Cellular processes Sporulation and germination RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)Transcription Transcription factors RNA polymerase sigma-G factor (TIGR02850; HMM-score: 15.4)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 15.4)RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 12.9)
- TheSEED :
- RNA polymerase sporulation specific sigma factor SigH
Dormancy and Sporulation Dormancy and Sporulation - no subcategory Sporulation-associated proteins with broader functions RNA polymerase sporulation specific sigma factor SigHand 2 more - PFAM: HTH (CL0123) Sigma70_r2; Sigma-70 region 2 (PF04542; HMM-score: 47)and 6 moreSigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 17.5)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 13.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.6)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.2)GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.4)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by SigH*, sigma factor controlling competence and phage integrase genes: in JSNZ, N315, NCTC8325
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8328
- Cytoplasmic Membrane Score: 0.0634
- Cell wall & surface Score: 0.0017
- Extracellular Score: 0.1022
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001521
- TAT(Tat/SPI): 0.000208
- LIPO(Sec/SPII): 0.000353
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKYDLTTQDSTIKRNNAINDKDFEKLVMDLQPLIIRRIKTFGFNHYDLEDLYQEILIRMYRSVQTFDFSGEQPFTNYVQCLITSVKYDYLRKYLATNKRMDNLINEYRVTYPCAIKRFDVENNYLNKLAIKELICQFKYLSAFEKDVMYLMCEQYKPREIAQLMHVKEKVIYNAIQRCKNKIKRYFKMI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Kazuya Morikawa, Yumiko Inose, Hideyuki Okamura, Atsushi Maruyama, Hideo Hayashi, Kunio Takeyasu, Toshiko Ohta
A new staphylococcal sigma factor in the conserved gene cassette: functional significance and implication for the evolutionary processes.
Genes Cells: 2003, 8(8);699-712
[PubMed:12875655] [WorldCat.org] [DOI] (P p)Liang Tao, Xiaoqian Wu, Baolin Sun
Alternative sigma factor sigmaH modulates prophage integration and excision in Staphylococcus aureus.
PLoS Pathog: 2010, 6(5);e1000888
[PubMed:20485515] [WorldCat.org] [DOI] (I e)Kazuya Morikawa, Aya J Takemura, Yumiko Inose, Melody Tsai, Le Thuy Nguyen Thi, Toshiko Ohta, Tarek Msadek
Expression of a cryptic secondary sigma factor gene unveils natural competence for DNA transformation in Staphylococcus aureus.
PLoS Pathog: 2012, 8(11);e1003003
[PubMed:23133387] [WorldCat.org] [DOI] (I p)