From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS11695 [old locus tag: SA2034 ]
  • pan locus tag?: SAUPAN005688000
  • symbol: SA_RS11695
  • pan gene symbol?: rpsH
  • synonym:
  • product: 30S ribosomal protein S8

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS11695 [old locus tag: SA2034 ]
  • symbol: SA_RS11695
  • product: 30S ribosomal protein S8
  • replicon: chromosome
  • strand: -
  • coordinates: 2301568..2301966
  • length: 399
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (2301568..2301966) NCBI
  • BioCyc: SA_RS11695 BioCyc
  • MicrobesOnline: see SA2034

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACAATGACAGATCCAATCGCAGATATGCTTACTCGTGTAAGAAACGCAAACATGGTG
    CGTCACGAGAAGTTAGAATTACCTGCATCAAATATTAAAAAAGAAATTGCTGAAATCTTA
    AAGAGTGAAGGTTTCATTAAAAATGTTGAATACGTAGAAGATGATAAACAAGGTGTACTT
    CGTTTATTCTTAAAATATGGTCAAAACGATGAGCGTGTTATCACAGGATTAAAACGTATT
    TCAAAACCAGGTTTACGTGTTTATGCAAAAGCTAGCGAAATGCCTAAAGTATTAAATGGT
    TTAGGTATTGCATTAGTATCAACTTCTGAAGGTGTAATCACTGACAAAGAAGCAAGAAAA
    CGTAATGTTGGTGGAGAAATTATCGCATACGTTTGGTAA
    60
    120
    180
    240
    300
    360
    399

⊟Protein[edit | edit source]

Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

⊟General[edit | edit source]

  • locus tag: SA_RS11695 [old locus tag: SA2034 ]
  • symbol: SA_RS11695
  • description: 30S ribosomal protein S8
  • length: 132
  • theoretical pI: 9.90457
  • theoretical MW: 14831.2
  • GRAVY: -0.284848

⊟Function[edit | edit source]

  • TIGRFAM:
    integral membrane protein (TIGR04561; HMM-score: 14.3)
    Unknown function General zinc finger protein ZPR1 homolog (TIGR00340; HMM-score: 12.5)
  • TheSEED: see SA2034
  • PFAM:
    no clan defined Ribosomal_S8; Ribosomal protein S8 (PF00410; HMM-score: 180.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004597
    • TAT(Tat/SPI): 0.000216
    • LIPO(Sec/SPII): 0.000697
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTMTDPIADMLTRVRNANMVRHEKLELPASNIKKEIAEILKSEGFIKNVEYVEDDKQGVLRLFLKYGQNDERVITGLKRISKPGLRVYAKASEMPKVLNGLGIALVSTSEGVITDKEARKRNVGGEIIAYVW

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS06280(nusA)transcription termination/antitermination protein NusA  [2] (data from MRSA252)
    SA_RS01275formate acetyltransferase  [2] (data from MRSA252)
    SA_RS01365L-lactate dehydrogenase  [2] (data from MRSA252)
    SA_RS02095alkyl hydroperoxide reductase subunit C  [2] (data from MRSA252)
    SA_RS02490YbaB/EbfC family nucleoid-associated protein  [2] (data from MRSA252)
    SA_RS0265050S ribosomal protein L25/general stress protein Ctc  [2] (data from MRSA252)
    SA_RS0290550S ribosomal protein L11  [2] (data from MRSA252)
    SA_RS0291550S ribosomal protein L10  [2] (data from MRSA252)
    SA_RS0292050S ribosomal protein L7/L12  [2] (data from MRSA252)
    SA_RS02930DNA-directed RNA polymerase subunit beta  [2] (data from MRSA252)
    SA_RS0295030S ribosomal protein S7  [2] (data from MRSA252)
    SA_RS02955elongation factor G  [2] (data from MRSA252)
    SA_RS03155phosphate acetyltransferase  [2] (data from MRSA252)
    SA_RS03545hypothetical protein  [2] (data from MRSA252)
    SA_RS04140aldehyde dehydrogenase  [2] (data from MRSA252)
    SA_RS04145phosphoglycerate kinase  [2] (data from MRSA252)
    SA_RS04160enolase  [2] (data from MRSA252)
    SA_RS04325arsenate reductase  [2] (data from MRSA252)
    SA_RS04660NAD-specific glutamate dehydrogenase  [2] (data from MRSA252)
    SA_RS04680glucose-6-phosphate isomerase  [2] (data from MRSA252)
    SA_RS04720CoA-disulfide reductase  [2] (data from MRSA252)
    SA_RS04785beta-ketoacyl-[acyl-carrier-protein] synthase II  [2] (data from MRSA252)
    SA_RS04865oligoendopeptidase F  [2] (data from MRSA252)
    SA_RS04935hypothetical protein  [2] (data from MRSA252)
    SA_RS05190bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase  [2] (data from MRSA252)
    SA_RS05300phosphoenolpyruvate--protein phosphotransferase  [2] (data from MRSA252)
    SA_RS05330hypothetical protein  [2] (data from MRSA252)
    SA_RS05620thiol reductase thioredoxin  [2] (data from MRSA252)
    SA_RS05895isoleucine--tRNA ligase  [2] (data from MRSA252)
    SA_RS0614050S ribosomal protein L19  [2] (data from MRSA252)
    SA_RS06170succinyl-CoA ligase subunit alpha  [2] (data from MRSA252)
    SA_RS06235elongation factor Ts  [2] (data from MRSA252)
    SA_RS06490glutamine synthetase  [2] (data from MRSA252)
    SA_RS07700peptidase M24 family protein  [2] (data from MRSA252)
    SA_RS07880glycine--tRNA ligase  [2] (data from MRSA252)
    SA_RS07955molecular chaperone DnaK  [2] (data from MRSA252)
    SA_RS08435trigger factor  [2] (data from MRSA252)
    SA_RS08560pyruvate kinase  [2] (data from MRSA252)
    SA_RS08760formate--tetrahydrofolate ligase  [2] (data from MRSA252)
    SA_RS09005transaldolase  [2] (data from MRSA252)
    SA_RS09775methionine aminopeptidase  [2] (data from MRSA252)
    SA_RS09960manganese-dependent inorganic pyrophosphatase  [2] (data from MRSA252)
    SA_RS11145purine-nucleoside phosphorylase  [2] (data from MRSA252)
    SA_RS1163050S ribosomal protein L17  [2] (data from MRSA252)
    SA_RS1164030S ribosomal protein S11  [2] (data from MRSA252)
    SA_RS1164530S ribosomal protein S13  [2] (data from MRSA252)
    SA_RS11660adenylate kinase  [2] (data from MRSA252)
    SA_RS1169050S ribosomal protein L6  [2] (data from MRSA252)
    SA_RS1173530S ribosomal protein S3  [2] (data from MRSA252)
    SA_RS1175550S ribosomal protein L23  [2] (data from MRSA252)
    SA_RS120602-hydroxyacid dehydrogenase  [2] (data from MRSA252)
    SA_RS13375hydroxymethylglutaryl-CoA synthase  [2] (data from MRSA252)
    SA_RS13730class I fructose-bisphosphate aldolase  [2] (data from MRSA252)
    SA_RS13915ornithine carbamoyltransferase  [2] (data from MRSA252)
    SA_RS13920arginine deiminase  [2] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ R Allyn Forsyth, Robert J Haselbeck, Kari L Ohlsen, Robert T Yamamoto, Howard Xu, John D Trawick, Daniel Wall, Liangsu Wang, Vickie Brown-Driver, Jamie M Froelich, Kedar G C, Paula King, Melissa McCarthy, Cheryl Malone, Brian Misiner, David Robbins, Zehui Tan, Zhan-yang Zhu Zy, Grant Carr, Deborah A Mosca, Carlos Zamudio, J Gordon Foulkes, Judith W Zyskind
    A genome-wide strategy for the identification of essential genes in Staphylococcus aureus.
    Mol Microbiol: 2002, 43(6);1387-400
    [PubMed:11952893] [WorldCat.org] [DOI] (P p)
  2. ↑ 2.00 2.01 2.02 2.03 2.04 2.05 2.06 2.07 2.08 2.09 2.10 2.11 2.12 2.13 2.14 2.15 2.16 2.17 2.18 2.19 2.20 2.21 2.22 2.23 2.24 2.25 2.26 2.27 2.28 2.29 2.30 2.31 2.32 2.33 2.34 2.35 2.36 2.37 2.38 2.39 2.40 2.41 2.42 2.43 2.44 2.45 2.46 2.47 2.48 2.49 2.50 2.51 2.52 2.53 2.54 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA_RS11695&oldid=102384"