From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01997
  • pan locus tag?: SAUPAN004840000
  • symbol: SAOUHSC_01997
  • pan gene symbol?: perR
  • synonym:
  • product: ferric uptake regulator-like protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01997
  • symbol: SAOUHSC_01997
  • product: ferric uptake regulator-like protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1907224..1907670
  • length: 447
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
    CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
    CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
    AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
    TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
    ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
    AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
    GTTTGTAAAGAATGCCAAGATAAATAA
    60
    120
    180
    240
    300
    360
    420
    447

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01997
  • symbol: SAOUHSC_01997
  • description: ferric uptake regulator-like protein
  • length: 148
  • theoretical pI: 5.47242
  • theoretical MW: 17183.2
  • GRAVY: -0.421622

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Peroxide stress regulator PerR, FUR family
    Stress Response Oxidative stress Oxidative stress  Peroxide stress regulator PerR, FUR family
  • PFAM:
    HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 138.1)
    and 11 more
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 17.2)
    no clan defined Type2_restr_D3; Type-2 restriction enzyme D3 domain (PF16902; HMM-score: 16.3)
    SR1P; SR1 protein (PF13790; HMM-score: 14.9)
    C2H2-zf (CL0361) zf-BED; BED zinc finger (PF02892; HMM-score: 13.8)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.7)
    no clan defined E6; Early Protein (E6) (PF00518; HMM-score: 13.6)
    DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 12.4)
    Zn_Beta_Ribbon (CL0167) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 11)
    no clan defined DUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 10.8)
    Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 10.5)
    Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.4)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009002
    • TAT(Tat/SPI): 0.003688
    • LIPO(Sec/SPII): 0.001527
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: FapR* (repression) regulon, PerR* (repression) regulon
    FapR*(TF)important in Fatty acid biosynthesis; RegPrecise 
    PerR*(TF)important in Oxidative stress response; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

M J Horsburgh, M O Clements, H Crossley, E Ingham, S J Foster
PerR controls oxidative stress resistance and iron storage proteins and is required for virulence in Staphylococcus aureus.
Infect Immun: 2001, 69(6);3744-54
[PubMed:11349039] [WorldCat.org] [DOI] (P p)Malcolm J Horsburgh, Stephen J Wharton, Alan G Cox, Eileen Ingham, Sharon Peacock, Simon J Foster
MntR modulates expression of the PerR regulon and superoxide resistance in Staphylococcus aureus through control of manganese uptake.
Mol Microbiol: 2002, 44(5);1269-86
[PubMed:12028379] [WorldCat.org] [DOI] (P p)Sami Maalej, Ines Dammak, Sam Dukan
The impairment of superoxide dismutase coordinates the derepression of the PerR regulon in the response of Staphylococcus aureus to HOCl stress.
Microbiology (Reading): 2006, 152(Pt 3);855-861
[PubMed:16514164] [WorldCat.org] [DOI] (P p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAOUHSC_01997&oldid=94899"