⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01997
- pan locus tag?: SAUPAN004840000
- symbol: SAOUHSC_01997
- pan gene symbol?: perR
- synonym:
- product: ferric uptake regulator-like protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01997
- symbol: SAOUHSC_01997
- product: ferric uptake regulator-like protein
- replicon: chromosome
- strand: -
- coordinates: 1907224..1907670
- length: 447
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921877 NCBI
- RefSeq: YP_500494 NCBI
- BioCyc: G1I0R-1892 BioCyc
- MicrobesOnline: 1290450 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTGTTGAAATAGAATCAATTGAACATGAACTAGAAGAATCAATTGCATCATTGCGA
CAAGCAGGCGTAAGAATTACACCTCAAAGACAAGCAATATTACGTTATTTAATTTCTTCA
CATACTCATCCAACAGCTGATGAAATTTATCAAGCACTTTCACCTGATTTTCCAAATATA
AGTGTTGCGACAATATATAATAACTTAAGAGTGTTTAAAGATATTGGAATTGTAAAAGAA
TTAACATATGGAGACTCATCAAGTCGATTCGACTTTAATACACATAATCATTATCATATT
ATATGTGAACAATGTGGTAAGATTGTTGATTTTCAATATCCACAGTTAAATGAAATTGAA
AGATTAGCTCAGCATATGACTGACTTTGACGTAACACATCATCGAATGGAAATTTATGGA
GTTTGTAAAGAATGCCAAGATAAATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01997
- symbol: SAOUHSC_01997
- description: ferric uptake regulator-like protein
- length: 148
- theoretical pI: 5.47242
- theoretical MW: 17183.2
- GRAVY: -0.421622
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Peroxide stress regulator PerR, FUR family
- PFAM: HTH (CL0123) FUR; Ferric uptake regulator family (PF01475; HMM-score: 132.9)and 11 moreHTH_20; Helix-turn-helix domain (PF12840; HMM-score: 24.2)HTH_11; HTH domain (PF08279; HMM-score: 14.9)no clan defined Eplus_motif; E+ motif (PF20430; HMM-score: 14.6)HEF_HK; HEF_HK domain (PF19191; HMM-score: 13.7)DUF2039; Uncharacterized conserved protein (DUF2039) (PF10217; HMM-score: 13.6)E6; Early Protein (E6) (PF00518; HMM-score: 13.2)Tbcl_zf (CL0839) zf-dskA_traR; Prokaryotic dksA/traR C4-type zinc finger (PF01258; HMM-score: 13.1)no clan defined DASH_Hsk3; DASH complex subunit Hsk3 like (PF08227; HMM-score: 13.1)HTH (CL0123) HTH_32; Homeodomain-like domain (PF13565; HMM-score: 12.5)Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 11.8)Ribosomal_L37e; Ribosomal protein L37e (PF01907; HMM-score: 10.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors: Hydrogen peroxide; Iron ion (Fe2+) and Manganese ion (Mn2+) act as corepressor
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8939
- Cytoplasmic Membrane Score: 0.0034
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.1025
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009002
- TAT(Tat/SPI): 0.003688
- LIPO(Sec/SPII): 0.001527
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: FapR* (repression) regulon, PerR* (repression) regulon
FapR* (TF) important in Fatty acid biosynthesis; RegPrecise PerR* (TF) important in Oxidative stress response; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
M J Horsburgh, M O Clements, H Crossley, E Ingham, S J Foster
PerR controls oxidative stress resistance and iron storage proteins and is required for virulence in Staphylococcus aureus.
Infect Immun: 2001, 69(6);3744-54
[PubMed:11349039] [WorldCat.org] [DOI] (P p)Malcolm J Horsburgh, Stephen J Wharton, Alan G Cox, Eileen Ingham, Sharon Peacock, Simon J Foster
MntR modulates expression of the PerR regulon and superoxide resistance in Staphylococcus aureus through control of manganese uptake.
Mol Microbiol: 2002, 44(5);1269-86
[PubMed:12028379] [WorldCat.org] [DOI] (P p)Sami Maalej, Ines Dammak, Sam Dukan
The impairment of superoxide dismutase coordinates the derepression of the PerR regulon in the response of Staphylococcus aureus to HOCl stress.
Microbiology (Reading): 2006, 152(Pt 3);855-861
[PubMed:16514164] [WorldCat.org] [DOI] (P p)
