Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS09195 [old locus tag: SACOL1794 ]
- pan locus tag?: SAUPAN004411000
- symbol: SACOL_RS09195
- pan gene symbol?: —
- synonym:
- product: thiol reductase thioredoxin
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS09195 [old locus tag: SACOL1794 ]
- symbol: SACOL_RS09195
- product: thiol reductase thioredoxin
- replicon: chromosome
- strand: -
- coordinates: 1842545..1842856
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (1842545..1842856) NCBI
- BioCyc: SACOL_RS09195 BioCyc
- MicrobesOnline: see SACOL1794
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAACAACTTGAATCAGAACAACAATTTGAATCTTTAAAACAAGGTGCTACAGTATTT
GAATTCACTGCAGGCTGGTGTCCAGATTGTAGAGTGATAGAACCAGATTTACCGGAATTA
GAAGCGAGATATCCTATGTTTGACTTCGTATCAGTAGACCGTGATAAATTTATGGATATT
TGTATTGAAAATGGTATTATGGGTATTCCAAGTTTTCTAGTATATAAAAATGGAGAACTG
CTTGGAAGTTATATTGGAAAAGAACGAAAATCAATTGAACAGATAGATGCATTTTTAGCT
CAATACGTGTAA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS09195 [old locus tag: SACOL1794 ]
- symbol: SACOL_RS09195
- description: thiol reductase thioredoxin
- length: 103
- theoretical pI: 4.14259
- theoretical MW: 11855.5
- GRAVY: -0.168932
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 47.6)and 6 moreprotein disulfide isomerase (TIGR01130; HMM-score: 26.4)Protein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 24.9)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 19.2)glutaredoxin-like protein (TIGR02200; HMM-score: 16.2)glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 14.6)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 13.1)
- TheSEED: see SACOL1794
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 59.3)and 6 moreThioredoxin_9; Thioredoxin (PF14595; HMM-score: 25.3)Phosducin; Phosducin (PF02114; HMM-score: 16.2)Thioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 15.2)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 14.9)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 12.9)DSBA; DSBA-like thioredoxin domain (PF01323; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9735
- Cytoplasmic Membrane Score: 0.0007
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0251
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013564
- TAT(Tat/SPI): 0.002238
- LIPO(Sec/SPII): 0.007556
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGELLGSYIGKERKSIEQIDAFLAQYV
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL1794
- protein localization: see SACOL1794
- quantitative data / protein copy number per cell: see SACOL1794
- interaction partners:
SACOL_RS04330 enolase [1] (data from MRSA252) SACOL_RS07705 DNA-binding protein HU [1] (data from MRSA252) SACOL_RS08345 molecular chaperone DnaK [1] (data from MRSA252) SACOL_RS08680 50S ribosomal protein L21 [1] (data from MRSA252) SACOL_RS08930 pyruvate kinase [1] (data from MRSA252) SACOL_RS11435 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SACOL_RS11765 50S ribosomal protein L2 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)