From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • pan locus tag?: SAUPAN004308000
  • symbol: SACOL_RS08860
  • pan gene symbol?: nrdR
  • synonym:
  • product: transcriptional regulator NrdR

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • symbol: SACOL_RS08860
  • product: transcriptional regulator NrdR
  • replicon: chromosome
  • strand: -
  • coordinates: 1764387..1764857
  • length: 471
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1764387..1764857) NCBI
  • BioCyc: SACOL_RS08860 BioCyc
  • MicrobesOnline: see SACOL1733

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAATGCCCGAAATGTAATTCTACACAATCTAAAGTTGTAGATTCAAGGCATGCCGAT
    GAATTAAATGCCATTCGAAGACGAAGAGAATGTGAAAATTGTGGAACACGTTTCACTACA
    TTTGAACATATCGAAGTTAGTCAGCTTATAGTTGTGAAAAAAGATGGCACAAGAGAGCAG
    TTTTCAAGAGAAAAGATACTTAATGGACTTGTGCGTTCTTGTGAGAAACGACCAGTTAGA
    TATCAACAACTTGAAGACATAACTAACAAGGTTGAATGGCAATTACGAGATGAAGGTCAT
    ACGGAAGTGTCTTCACGAGATATAGGTGAACACGTTATGAACTTGTTAATGCATGTTGAT
    CAAGTTTCATATGTTAGATTTGCATCAGTCTATAAAGAATTTAAAGATGTTGATCAATTG
    TTAGCATCGATGCAAGGGATTTTAAGCGAAAACAAACGGAGTGATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08860 [old locus tag: SACOL1733 ]
  • symbol: SACOL_RS08860
  • description: transcriptional regulator NrdR
  • length: 156
  • theoretical pI: 7.89688
  • theoretical MW: 18203.5
  • GRAVY: -0.744872

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 187.7)
    and 4 more
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 16.4)
    Signal transduction Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 14.6)
    MJ0042 family finger-like domain (TIGR02098; HMM-score: 12)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.7)
  • TheSEED: see SACOL1733
  • PFAM:
    no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 77.7)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_NrdR; Transcriptional repressor NrdR-like, N-terminal domain (PF22811; HMM-score: 72.3)
    and 18 more
    C2H2-zf (CL0361) zf-DBF; DBF zinc finger (PF07535; HMM-score: 19.5)
    Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 16.3)
    no clan defined DUF7117; Family of unknown function (DUF7117) (PF23430; HMM-score: 15.4)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 15)
    Zn_ribbon_GRF_2; GRF-like zinc ribbon domain (PF23549; HMM-score: 14.7)
    Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.1)
    Zn_ribbon_5; zinc-ribbon domain (PF13719; HMM-score: 14.1)
    DUF7129; Domain of unknown function (DUF7129) (PF23455; HMM-score: 13.3)
    Zn_ribbon_Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 13.1)
    Zn_ribbon_TFIIS; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.6)
    Ogr_Delta; Ogr/Delta-like zinc finger (PF04606; HMM-score: 11.9)
    no clan defined DUF7351; Domain of unknown function (DUF7351) (PF24042; HMM-score: 11.7)
    C2H2-zf (CL0361) zf-C2H2; Zinc finger, C2H2 type (PF00096; HMM-score: 11.4)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_PaaD; PaaD zinc beta ribbon domain (PF23451; HMM-score: 11.3)
    Zn_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 10.7)
    Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 9.7)
    no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 9.3)
    HEWD; HEWD domain (PF20576; HMM-score: 8.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • genes regulated by NrdR, TF important in Deoxyribonucleotide biosynthesis: see SACOL1733

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9776
    • Cytoplasmic Membrane Score: 0.0025
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0198
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016516
    • TAT(Tat/SPI): 0.00067
    • LIPO(Sec/SPII): 0.005624
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQFSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVDQVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1733
  • protein localization: see SACOL1733
  • quantitative data / protein copy number per cell: see SACOL1733
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]