From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
  • pan locus tag?: SAUPAN004308000
  • symbol: nrdR
  • pan gene symbol?: nrdR
  • synonym:
  • product: transcriptional regulator NrdR

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
  • symbol: nrdR
  • product: transcriptional regulator NrdR
  • replicon: chromosome
  • strand: -
  • coordinates: 1764387..1764857
  • length: 471
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAATGCCCGAAATGTAATTCTACACAATCTAAAGTTGTAGATTCAAGGCATGCCGAT
    GAATTAAATGCCATTCGAAGACGAAGAGAATGTGAAAATTGTGGAACACGTTTCACTACA
    TTTGAACATATCGAAGTTAGTCAGCTTATAGTTGTGAAAAAAGATGGCACAAGAGAGCAG
    TTTTCAAGAGAAAAGATACTTAATGGACTTGTGCGTTCTTGTGAGAAACGACCAGTTAGA
    TATCAACAACTTGAAGACATAACTAACAAGGTTGAATGGCAATTACGAGATGAAGGTCAT
    ACGGAAGTGTCTTCACGAGATATAGGTGAACACGTTATGAACTTGTTAATGCATGTTGAT
    CAAGTTTCATATGTTAGATTTGCATCAGTCTATAAAGAATTTAAAGATGTTGATCAATTG
    TTAGCATCGATGCAAGGGATTTTAAGCGAAAACAAACGGAGTGATGCTTAA
    60
    120
    180
    240
    300
    360
    420
    471

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1733 [new locus tag: SACOL_RS08860 ]
  • symbol: NrdR
  • description: transcriptional regulator NrdR
  • length: 156
  • theoretical pI: 7.89688
  • theoretical MW: 18203.5
  • GRAVY: -0.744872

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator NrdR (TIGR00244; HMM-score: 187.7)
    and 4 more
    Cys-rich peptide, TIGR04165 family (TIGR04165; HMM-score: 16.4)
    Signal transduction Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 14.6)
    MJ0042 family finger-like domain (TIGR02098; HMM-score: 12)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 8.7)
  • TheSEED  :
    • Ribonucleotide reductase transcriptional regulator NrdR
    Nucleosides and Nucleotides Nucleosides and Nucleotides - no subcategory Ribonucleotide reduction  Ribonucleotide reductase transcriptional regulator NrdR
  • PFAM:
    no clan defined ATP-cone; ATP cone domain (PF03477; HMM-score: 77.7)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_NrdR; Transcriptional repressor NrdR-like, N-terminal domain (PF22811; HMM-score: 72.3)
    and 18 more
    C2H2-zf (CL0361) zf-DBF; DBF zinc finger (PF07535; HMM-score: 19.5)
    Zn_Beta_Ribbon (CL0167) Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 16.3)
    no clan defined DUF7117; Family of unknown function (DUF7117) (PF23430; HMM-score: 15.4)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 15)
    Zn_ribbon_GRF_2; GRF-like zinc ribbon domain (PF23549; HMM-score: 14.7)
    Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 14.1)
    Zn_ribbon_5; zinc-ribbon domain (PF13719; HMM-score: 14.1)
    DUF7129; Domain of unknown function (DUF7129) (PF23455; HMM-score: 13.3)
    Zn_ribbon_Elf1; Transcription elongation factor Elf1 like (PF05129; HMM-score: 13.1)
    Zn_ribbon_TFIIS; Transcription factor S-II (TFIIS) (PF01096; HMM-score: 12.6)
    Ogr_Delta; Ogr/Delta-like zinc finger (PF04606; HMM-score: 11.9)
    no clan defined DUF7351; Domain of unknown function (DUF7351) (PF24042; HMM-score: 11.7)
    C2H2-zf (CL0361) zf-C2H2; Zinc finger, C2H2 type (PF00096; HMM-score: 11.4)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_PaaD; PaaD zinc beta ribbon domain (PF23451; HMM-score: 11.3)
    Zn_ribbon_4; zinc-ribbon domain (PF13717; HMM-score: 10.7)
    Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 9.7)
    no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 9.3)
    HEWD; HEWD domain (PF20576; HMM-score: 8.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effector: Deoxyribonucleotides
  • genes regulated by NrdR, TF important in Deoxyribonucleotide biosynthesisRegPrecise
    repression
    nrdG < nrdD
    transcription unit transferred from N315 data RegPrecise

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9776
    • Cytoplasmic Membrane Score: 0.0025
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0198
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.016516
    • TAT(Tat/SPI): 0.00067
    • LIPO(Sec/SPII): 0.005624
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKCPKCNSTQSKVVDSRHADELNAIRRRRECENCGTRFTTFEHIEVSQLIVVKKDGTREQFSREKILNGLVRSCEKRPVRYQQLEDITNKVEWQLRDEGHTEVSSRDIGEHVMNLLMHVDQVSYVRFASVYKEFKDVDQLLASMQGILSENKRSDA

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 92 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1733&oldid=92462"