Jump to navigation
		Jump to search
		
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1994 [new locus tag: SACOL_RS10420 ]
- pan locus tag?: SAUPAN004997000
- symbol: SACOL1994
- pan gene symbol?: pmtC
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1994 [new locus tag: SACOL_RS10420 ]
- symbol: SACOL1994
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2055868..2056740
- length: 873
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238035 NCBI
- RefSeq: YP_186818 NCBI
- BioCyc: see SACOL_RS10420
- MicrobesOnline: 913472 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
 61
 121
 181
 241
 301
 361
 421
 481
 541
 601
 661
 721
 781
 841ATGAAATTAGAACATATTACAAAAAAATACGGCTCAAATGTCGTTTTAAATGATATTGAT
 TTTGACTTTGGCGATAGTAGAATTGTCGGATTAATAGGAAAAAACGGTGTTGGTAAAACA
 ACCGTTATGAAAGTAATGAATGGTAATATTATTAAATTTGATGGAAAAGTAGATATTGAT
 AATGCAGATAATATCGGTTTTTTAATTGAGCATCCTAAATTATATGATAATAAATCAGGA
 TTGTATAACTTGAAATTATTTGCACAAGTATTAGGTAAGGGTTTTGATAAAGCATACACA
 GACAAAATTATAGATGCATTTGGTATGAGACCTTATATTAAAAAGAAAGTTAAGAAATAT
 TCAATGGGGATGAAGCAAAAGTTAGCAATTGCAGTATCTTTAATGAATAAACCTAAATTT
 TTAATCTTGGATGAGCCTACAAATGGTATGGATCCAGATGGCTCAATTGATGTGCTGACT
 ACAATTAAGTCTTTAGTAAATGAACTTGATATGAGAATTCTAATATCAAGTCATAAGTTA
 GAAGATATTGAATTAATTTGTGATAGAGCTGTATTTTTAAGAGACGGACATTTTGTTCAA
 GATGTAAACATGGAGGAAGGTGTTGCATCTGACACAACGATAGTTACTGTTGATCATAAA
 GACTTTGATAGAACTGAAAAATATCTTGCAGAGCATTTCCAATTACAAAATGTCGACAAA
 GCAGACGGACATTTAATGATCAATGCACAAAAAAATTATCAAGTTATACTAAAAGCATTA
 TCTGAATTAGATATTTATCCGAAATATATTGAAACACGTAAAAGTTCATTGCGTGATACG
 TACTTCAATATAAATCAAAGAGGTGATAAATAA60
 120
 180
 240
 300
 360
 420
 480
 540
 600
 660
 720
 780
 840
 873
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1994 [new locus tag: SACOL_RS10420 ]
- symbol: SACOL1994
- description: ABC transporter ATP-binding protein
- length: 290
- theoretical pI: 7.76705
- theoretical MW: 32951.8
- GRAVY: -0.331034
⊟Function[edit | edit source]
- TIGRFAM: lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 158.7)and 72 moreTransport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 122.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 104.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 102.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 98.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 96.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 96.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 94.4)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 89.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 88.2)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 86.5)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 84.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 83.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 82.8)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 80.4)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 78)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 77)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 76.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 76.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 72.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 72.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 72.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 71)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 69.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 68.3)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 67.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 67.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 67.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 65.1)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 63.2)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 63.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 63.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 62)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 61.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 61.3)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 60.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 60.4)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 58.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 57.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.8)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 56.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 55.3)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 54.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 52.7)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 50.4)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 50.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 49.2)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 49.2)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 49.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 49.1)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 48.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 46.5)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 45.7)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 43.8)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 43.8)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 38)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 36.8)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 35.1)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 34)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 30.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 28)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 23.4)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 23.4)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 21.6)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 16.2)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 15.1)
- TheSEED  : - ABC transporter, ATP-binding protein
 
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 84.7)and 11 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 40.5)AAA_23; AAA domain (PF13476; HMM-score: 18.4)AAA_15; AAA ATPase domain (PF13175; HMM-score: 17)AAA_22; AAA domain (PF13401; HMM-score: 15)PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 14.5)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.2)Reo_sigma (CL0326) TAdV_Fibre-like_head; Turkey Adenovirus 3 Fibre protein-like, head domain (PF22439; HMM-score: 14.2)P-loop_NTPase (CL0023) MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 13.5)AAA_30; AAA domain (PF13604; HMM-score: 11.4)AAA_14; AAA domain (PF13173; HMM-score: 11.3)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 9.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
 
- DeepLocPro: Cytoplasmic- Cytoplasmic Score: 0.4348
- Cytoplasmic Membrane Score: 0.2408
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.3241
 
- LocateP: Intracellular - Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
 
- SignalP: no predicted signal peptide- SP(Sec/SPI): 0.012898
- TAT(Tat/SPI): 0.000264
- LIPO(Sec/SPII): 0.000482
 
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLEHITKKYGSNVVLNDIDFDFGDSRIVGLIGKNGVGKTTVMKVMNGNIIKFDGKVDIDNADNIGFLIEHPKLYDNKSGLYNLKLFAQVLGKGFDKAYTDKIIDAFGMRPYIKKKVKKYSMGMKQKLAIAVSLMNKPKFLILDEPTNGMDPDGSIDVLTTIKSLVNELDMRILISSHKLEDIELICDRAVFLRDGHFVQDVNMEEGVASDTTIVTVDHKDFDRTEKYLAEHFQLQNVDKADGHLMINAQKNYQVILKALSELDIYPKYIETRKSSLRDTYFNINQRGDK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 107 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: PmtR* (repression) regulonPmtR* (TF) important in Hypothetical ABC transporter; RegPrecise transcription unit transferred from N315 data RegPrecise 
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker  
 A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
 PLoS One: 2009, 4(12);e8176
 [PubMed:19997597] [WorldCat.org] [DOI] (I e)
- ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher  
 The Staphylococcus aureus proteome.
 Int J Med Microbiol: 2014, 304(2);110-20
 [PubMed:24439828] [WorldCat.org] [DOI] (I p)
- ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker  
 Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
 Sci Rep: 2016, 6;28172
 [PubMed:27344979] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Som S Chatterjee, Hwang-Soo Joo, Anthony C Duong, Thomas D Dieringer, Vee Y Tan, Yan Song, Elizabeth R Fischer, Gordon Y C Cheung, Min Li, Michael Otto  
Essential Staphylococcus aureus toxin export system. 
Nat Med: 2013, 19(3);364-7 
[PubMed:23396209]  [WorldCat.org] [DOI] (I p)